DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and D1044.7

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_498177.1 Gene:D1044.7 / 175758 WormBaseID:WBGene00017032 Length:400 Species:Caenorhabditis elegans


Alignment Length:252 Identity:58/252 - (23%)
Similarity:76/252 - (30%) Gaps:86/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQN---GSCKIPGECECYDGFVRND 172
            |.|.|..:.|.........|.:||         :|.....|.|   .:|...| ..|:.|.: :.
 Worm    80 SSPQVSASGQVVTCFTNSQCASGY---------ICSNGACCPNTNSNTCSTTG-TPCFTGQI-SV 133

  Fly   173 NGDCVFACPLG--CQNGQCYLDGS------CQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEP 229
            .|.|..:..:|  ||..:..|.||      |||..|:.                      |..:.
 Worm   134 GGQCFNSVNIGDRCQRSEQCLGGSQCQNNLCQCPNGFA----------------------NVNQK 176

  Fly   230 EICGCSKGYQLTDDGCQPVCEP--DCGIGGLCKD----NNQ-CDCAPGYNLRDGVC----QADCY 283
              |.|..|..|.:..|..:..|  :|.|...|.|    ||| |.|...|.|..|.|    .:.|.
 Worm   177 --CACQLGTVLFNSQCITLASPGQNCQISSQCIDNSVCNNQMCSCNGNYRLVFGYCVPFTNSKCQ 239

  Fly   284 Q-----------------------------KCNNGVCVSRNRCLCDPGYTYHEQSTM 311
            |                             .||:|.|...|......||....|||:
 Worm   240 QTQTLVNNQCVLLSIVGETCIANQQCVGGAMCNSGTCRCTNGATAMYGYCISSQSTV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB5NP_001188802.1 None
D1044.7NP_498177.1 EB 126..177 CDD:279949 15/75 (20%)
EB 179..230 CDD:279949 17/50 (34%)
EB 238..289 CDD:279949 8/50 (16%)
EB 299..349 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.