Sequence 1: | NP_001188802.1 | Gene: | NimB5 / 34815 | FlyBaseID: | FBgn0028936 | Length: | 315 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498177.1 | Gene: | D1044.7 / 175758 | WormBaseID: | WBGene00017032 | Length: | 400 | Species: | Caenorhabditis elegans |
Alignment Length: | 252 | Identity: | 58/252 - (23%) |
---|---|---|---|
Similarity: | 76/252 - (30%) | Gaps: | 86/252 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 SYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQN---GSCKIPGECECYDGFVRND 172
Fly 173 NGDCVFACPLG--CQNGQCYLDGS------CQCDPGYKLDETRRFCRPICSSGCGSSPRHNCTEP 229
Fly 230 EICGCSKGYQLTDDGCQPVCEP--DCGIGGLCKD----NNQ-CDCAPGYNLRDGVC----QADCY 283
Fly 284 Q-----------------------------KCNNGVCVSRNRCLCDPGYTYHEQSTM 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimB5 | NP_001188802.1 | None | |||
D1044.7 | NP_498177.1 | EB | 126..177 | CDD:279949 | 15/75 (20%) |
EB | 179..230 | CDD:279949 | 17/50 (34%) | ||
EB | 238..289 | CDD:279949 | 8/50 (16%) | ||
EB | 299..349 | CDD:279949 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |