DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and F07H5.8

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_495874.3 Gene:F07H5.8 / 174407 WormBaseID:WBGene00008559 Length:835 Species:Caenorhabditis elegans


Alignment Length:238 Identity:51/238 - (21%)
Similarity:83/238 - (34%) Gaps:84/238 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QHKCRIWVPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSASRLMGVTVCRAQCGCQNGSCKIP 159
            |.:|:....|..:|.|:: ::...||::: .....|           ..||.::| .||...:| 
 Worm   645 QPQCQPACQPSCMETYTF-TIPMNDQSSK-QCAPAC-----------QPVCDSKC-IQNYQFEI- 694

  Fly   160 GECECYDGFVRNDNGDCVFACPLGC------QNGQCYLDGSCQC----------------DPGYK 202
                    .:...:.:|:.||...|      ||.|.....|..|                :|.:|
 Worm   695 --------VIPQADNNCMPACTQSCQTSCVQQNSQSVPQCSTACTDSCRSSCVEIVKESAEPTFK 751

  Fly   203 LD-------ETRRFCRPICSSGCGSSPRHN-CTEPEIC--GCSKGYQLTDDGCQPVC----EPDC 253
            |:       |....|.|.|::.|....:.. .|:.|.|  .|       .:.||..|    || |
 Worm   752 LEIVLKKPMEETVTCAPQCANQCVDQCKTQLLTQIEFCLPAC-------QNACQQNCPLQVEP-C 808

  Fly   254 GIGGLCKDNNQCDCAPGYNLRDGVCQADCYQKCNNGVCVSRNR 296
            .:.|     :||:|:.|::|            |.|..|..:.|
 Worm   809 AMSG-----SQCNCSTGFSL------------CGNNQCCRKRR 834



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.