DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB5 and CCBE1

DIOPT Version :9

Sequence 1:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_016881045.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens


Alignment Length:176 Identity:44/176 - (25%)
Similarity:55/176 - (31%) Gaps:63/176 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 CCTGYSASRLMGVTVCRAQCGCQNGSCKIPGECECYDGFVRNDNGDCVFACPLGCQNGQCYLDGS 194
            ||.||..  ::|..:......|....|    |.:|.|.|.|                      ..
Human    74 CCKGYKF--VLGQCIPEDYDVCAEAPC----EQQCTDNFGR----------------------VL 110

  Fly   195 CQCDPGYKLDETRR------FCRPI--CSSGCGSSPRHNCTE---PEICGCSKGYQLTDDGCQPV 248
            |.|.|||:.|..|.      :|..|  |:|..|:...|.|..   ...|.|.:||...|||    
Human   111 CTCYPGYRYDRERHRKREKPYCLDIDECASSNGTLCAHICINTLGSYRCECREGYIREDDG---- 171

  Fly   249 CEPDCGIG-------GLCKDNNQCDCAPGYNLRDGVCQADC---YQ 284
              ..|..|       |..|..|.        ::.|.|.|.|   ||
Human   172 --KTCTRGDKYPNDTGHEKSENM--------VKAGTCCATCKEFYQ 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.