DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and SCARF2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_699165.3 Gene:SCARF2 / 91179 HGNCID:19869 Length:871 Species:Homo sapiens


Alignment Length:375 Identity:94/375 - (25%)
Similarity:123/375 - (32%) Gaps:137/375 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCP-------- 178
            :..||.|||:...:....|.:....|.||..||..|:|.|...:   :..||...||        
Human    61 VPTCCAGWRQQGDECGIAVCEGNSTCSENEVCVRPGECRCRHGY---FGANCDTKCPRQFWGPDC 122

  Fly   179 ---------------------------------LGCPHGRCY-LNGTCQCDKG----------YE 199
                                             ..|.||.|: .:|.|:|:.|          |.
Human   123 KELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWWGAQCASACYC 187

  Fly   200 LDGSRKFCQPQ--------------CNATCGHNEVCLE--PGKCSCAEGYTRGLRESAALGCQPI 248
            ...||  |.||              ||..|..|....|  .|:|.|.| .|.|.|      |...
Human   188 SATSR--CDPQTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRE-RTFGAR------CDRY 243

  Fly   249 CIPDCGYGHCVRP--NECECFPGFQ-----------------KRKNG--------ITCEGDCYMT 286
            |  .|..|.| .|  ..|.|.||::                 :|:.|        ...||.| :|
Human   244 C--QCFRGRC-HPVDGTCACEPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPCTVAEGRC-LT 304

  Fly   287 CENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDN--CDNGVCISPGNC-RCFKGYVRNRERCEAV 348
            ||.|:...|....|..|: |.:..:...|.|.|.  |::    ..|.| ||..|::  .:|||..
Human   305 CEPGWNGTKCDQPCATGF-YGEGCSHRCPPCRDGHACNH----VTGKCTRCNAGWI--GDRCETK 362

  Fly   349 CVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCN-AMGRCRCQVGM 397
            |..|.  ||:       .||.|...      |..|.|: ..|||.|..|:
Human   363 CSNGT--YGE-------DCAFVCAD------CGSGHCDFQSGRCLCSPGV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
SCARF2NP_699165.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHA03247 <534..871 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.