DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and dkk2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001104679.1 Gene:dkk2 / 792404 ZFINID:ZDB-GENE-080204-14 Length:243 Species:Danio rerio


Alignment Length:278 Identity:58/278 - (20%)
Similarity:90/278 - (32%) Gaps:104/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTILRSLCLHSV-LLVLFLCV--LHGLELQLHEQQLQQQKDEQLRLRAEQRQRELLREHEALQR 62
            |.|:.||.|...: |:|.|:.:  ..|:|.|                 |:....:.|....|...
Zfish     1 MLTVTRSRCCWMLPLIVAFVRMGETQGIESQ-----------------AQVNSIKSLEPQPAAAN 48

  Fly    63 RLSSSTTTRKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNP-YMNVIEVCC 126
            |..:|.:.     ||...::|.:| :|  |..         |||. :||....:| :.....:.|
Zfish    49 RSGASYSG-----IPKKSNIPAQG-YP--CSS---------DKEC-VVGTYCHSPQHAPSRRLSC 95

  Fly   127 KGWRRYEYDWSQCVPDCGERCQENGFCVAGGKC---VC--------------------FTDFVLN 168
            :  ||            .:||..:..|..|.:|   :|                    |:....|
Zfish    96 R--RR------------KKRCHRDNMCCPGNRCSNYICIPISESALSSHKSSMDENNKFSIKEKN 146

  Fly   169 YRNNCVPTCPLGCPHGRCYLNG--------TCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPG 225
            ::.|       |..|.:..|.|        :..|.:||..  :|.|....|.......|||.:..
Zfish   147 WKKN-------GKAHAKISLKGHEGDPCLRSSDCSEGYCC--ARHFWTKICKPVLRQGEVCTKQR 202

  Fly   226 K-----------CSCAEG 232
            |           |.||:|
Zfish   203 KKGSHGLEIFQRCDCAKG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
dkk2NP_001104679.1 Dickkopf_N 70..120 CDD:282549 15/73 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.