DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Esm1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_076101.1 Gene:Esm1 / 71690 MGIID:1918940 Length:184 Species:Mus musculus


Alignment Length:146 Identity:33/146 - (22%)
Similarity:48/146 - (32%) Gaps:60/146 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 DCGDNCDNGVCISPGNCRCFKGYVRNRERCEAVCVGGCGFYGKCIAPNVCG-CAIVPGPERTYQ- 378
            ||.::||...|             |:..||:...:..||    |     |. ||..|| |..|: 
Mouse    27 DCPEHCDKTEC-------------RSSLRCKRTVLDDCG----C-----CQVCAAGPG-ETCYRT 68

  Fly   379 -------------RC-----------EYGLC----------NAMGRCRCQVGM-TRFIDRCMSPD 408
                         :|           |:|:|          .....|.||.|: .|...||:...
Mouse    69 VSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFP 133

  Fly   409 TVTTYASMNPVKVNAS 424
            .....|:.:|.:.:||
Mouse   134 FFQYAAAKSPSRTSAS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Esm1NP_076101.1 IGFBP 28..83 CDD:278641 17/77 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.