DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and TNR

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:406 Identity:82/406 - (20%)
Similarity:135/406 - (33%) Gaps:150/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLCLHSVLLVLFLCVLHGL------ELQLHEQQLQQQKDEQ------------------------ 41
            ::.|.::|:.:.|.:|..:      :|::..:::|:|..|:                        
Human     7 TVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKEQPVVFNHVYNI 71

  Fly    42 -----------LRLRAEQRQRELLREHEALQRRLSSSTTTRKPYIIPNGLSLPRRG---EHPDKC 92
                       |...|||   |:..|.|.|...:..::.........:.::.|::.   ....:.
Human    72 NVPLDNLCSSGLEASAEQ---EVSAEDETLAEYMGQTSDHESQVTFTHRINFPKKACPCASSAQV 133

  Fly    93 RQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENG------ 151
            .||:.:.....::||.::.:                         ||..:|   |||:.      
Human   134 LQELLSRIEMLEREVSVLRD-------------------------QCNANC---CQESAATGQLD 170

  Fly   152 ---FCVAGGK-------CVCFTDFVLNYRNNC-VPTCPLGCPHGRCYLNGTCQCDKGYELDGSRK 205
               .|...|.       |:|...:   :..|| .|.|||||......::|.|.||..|..|...:
Human   171 YIPHCSGHGNFSFESCGCICNEGW---FGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSE 232

  Fly   206 FCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGF 270
            .   :|...|....:|:: |:|.|.|.||.               .||                 
Human   233 L---RCPTDCSSRGLCVD-GECVCEEPYTG---------------EDC----------------- 261

  Fly   271 QKRKNGITCEGDCYMTCENGFCANKTTCVCQNGY-RYDKNTTTCLPDCG--DNCDNGVCISPGNC 332
                ..:.|.|||   ...|.||| .||:|:.|| ..|.....||..|.  ..|:.|:|:     
Human   262 ----RELRCPGDC---SGKGRCAN-GTCLCEEGYVGEDCGQRQCLNACSGRGQCEEGLCV----- 313

  Fly   333 RCFKGYVRNRERCEAV 348
             |.:||  ....|.||
Human   314 -CEEGY--QGPDCSAV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
TNRNP_003276.3 EGF_2 <208..230 CDD:285248 7/21 (33%)
EGF_2 267..292 CDD:285248 12/28 (43%)
EGF_2 299..323 CDD:285248 7/31 (23%)
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020
FReD 1133..1342 CDD:238040
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.