DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Megf10

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001001979.1 Gene:Megf10 / 70417 MGIID:2685177 Length:1147 Species:Mus musculus


Alignment Length:490 Identity:110/490 - (22%)
Similarity:155/490 - (31%) Gaps:189/490 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWR-----------RYEYDWSQC 139
            |:|...|.|..|.            .|.....::.....|..||.           |:   ...|
Mouse   228 GKHGPHCEQRCPC------------QNGGVCHHVTGECSCPSGWMGTVCGQPCPEGRF---GKNC 277

  Fly   140 VPDCGERCQENGFC-VAGGKCVCFTDFVLNYRNNCVPTCPLG-----------CPH-GRCY-LNG 190
            ..:|  :|...|.| .|.|:|.|...:.   ...|...||:|           |.: |:|| ::|
Mouse   278 SQEC--QCHNGGTCDAATGQCHCSPGYT---GERCQDECPVGSYGVRCAEACRCVNGGKCYHVSG 337

  Fly   191 TCQCDKGY-------------------------ELDGSRKFCQPQ--------------CNATCG 216
            ||.|:.|:                         .||.:.. |.|.              ||.||.
Mouse   338 TCLCEAGFSGELCEARLCPEGLYGIKCDKRCPCHLDNTHS-CHPMSGECGCKPGWSGLYCNETCS 401

  Fly   217 ---HNEVCLE-------------PGKCSCAEGY------------TRGLRESAALGCQ--PICIP 251
               :.|.|.:             .|:|:||.|:            ..|:..|:..||:  .:|.|
Mouse   402 PGFYGEACQQICSCQNGADCDSVTGRCACAPGFKGTDCSTPCPLGRYGINCSSRCGCKNDAVCSP 466

  Fly   252 DCGYGHCVRPNECECFPGFQKRKNGITCEG-----DCYMTCE--NGFCANKT--TCVCQNGYRYD 307
            ..|        .|.|..|:......|.|..     .|.:||:  ||...|..  ||.|..|:|..
Mouse   467 VDG--------SCICKAGWHGVDCSIRCPSGTWGFGCNLTCQCLNGGACNTLDGTCTCAPGWRGA 523

  Fly   308 KNTTTCLP-----DCGDNCD----NGVCISPGNCRCFKGYVRNRERCEAVCVGG-----CGF--- 355
            |....|..     :|.:.||    :|...:.|:|||..|:  :...|::||..|     |..   
Mouse   524 KCEFPCQDGTYGLNCAERCDCSHADGCHPTTGHCRCLPGW--SGVHCDSVCAEGRWGPNCSLPCY 586

  Fly   356 --YGKCIAPN--VCGCAIVPG---------------PERTYQRC-----EYGLCNAM-GRCRCQV 395
              .|...:|:  :|.||  ||               ..|..|.|     ..|.|:.: |.|.|..
Mouse   587 CKNGASCSPDDGICECA--PGFRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLP 649

  Fly   396 GMT-----------RFIDRCMSPDTVTTYASMNPV 419
            |.|           ||...|....|.|...:.||:
Mouse   650 GFTGALCNEVCPSGRFGKNCAGVCTCTNNGTCNPI 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Megf10NP_001001979.1 Necessary for interaction with AP2M1, self-assembly and formation of the irregular, mosaic-like adhesion pattern. /evidence=ECO:0000250|UniProtKB:Q96KG7 1..857 110/490 (22%)
EMI 32..99 CDD:284877
EGF_CA 281..326 CDD:304395 12/49 (24%)
EGF_CA 542..587 CDD:304395 13/46 (28%)
Necessary for formation of large intracellular vacuoles. /evidence=ECO:0000250|UniProtKB:Q96KG7 945..1147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1093..1147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.