DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Megf11

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:412 Identity:108/412 - (26%)
Similarity:136/412 - (33%) Gaps:146/412 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCC---------------------KGWRRYEYDWSQ 138
            |.|.|...::.....|..|..:|:..:....|                     :|.|......||
  Rat    23 EDPNVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQ 87

  Fly   139 CVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGS 203
            |.|.    ..|||            ||       |:|.|...|.||||....||.|:.|:.....
  Rat    88 CCPG----YYENG------------DF-------CIPLCTEECMHGRCVSPDTCHCEPGWGGPDC 129

  Fly   204 RKFCQ-----PQCNATCG-HNEVCLEP--GKCSCAEGYTRGLR--ESAA-----LGCQPICIPDC 253
            ...|.     |.|:..|. .|.....|  |.|.||.|: ||.|  |..|     .|||.:|  .|
  Rat   130 SSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGF-RGWRCEEFCAPGTHGKGCQLLC--QC 191

  Fly   254 GYGHCVRP--NECECFPGFQKRKNGITCEGDC-----------YMTCENGFCANKTT--CVCQNG 303
            .:|....|  .||.|.||:    .|:.||..|           ...|:||...:..|  |.|..|
  Rat   192 HHGASCDPRTGECLCAPGY----TGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPG 252

  Fly   304 Y------------RYDKNTTTCLPDC----GDNCDNGVCISPGNCRCFKGYVRNRERCEAVC-VG 351
            :            .:.:|   |..||    |..||:    ..|.|.|..||:  .:||:..| .|
  Rat   253 WTGAVCAQPCPPGTFGQN---CSQDCPCHHGGQCDH----VTGQCHCTAGYM--GDRCQEECPFG 308

  Fly   352 GCGFYGKCIAPNVCGCAIVPGPERTYQRCEY---GLCN-AMGRCRCQVG------MTRFIDR--- 403
            ..||                   |..|||:.   |.|: |.|.|.|:.|      ..|....   
  Rat   309 TFGF-------------------RCSQRCDCHNGGQCSPATGACECEPGYKGPSCQERLCPEGLH 354

  Fly   404 ---CMSP---DTVTTYASMNPV 419
               |.||   ||..| .|.:||
  Rat   355 GPGCTSPCPCDTENT-ISCHPV 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Megf11XP_038938374.1 EMI 26..93 CDD:400092 11/70 (16%)
EGF_CA 189..234 CDD:419698 13/50 (26%)
Laminin_EGF 275..320 CDD:395007 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.