DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Megf6

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_075244.1 Gene:Megf6 / 65049 RGDID:621188 Length:1574 Species:Rattus norvegicus


Alignment Length:426 Identity:109/426 - (25%)
Similarity:138/426 - (32%) Gaps:180/426 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SQCVP-----DCGERCQENGFCV-AGGKCVCFTDFVLNYRNNCVPTCPLG---------CPHGRC 186
            :||.|     |||:.|....|.| ..|.|.|...........|:  ||.|         ||.||.
  Rat   720 TQCPPGYQGEDCGQECPVGTFGVNCSGSCSCVGAPCHRVTGECL--CPPGKTGEDCGADCPEGRW 782

  Fly   187 YL------------------NGTCQCDKGYELDGSRKFCQPQCNA-----------TCGHNEVCL 222
            .|                  .|||.|..|:.  |||  ||..|:|           .|.::..| 
  Rat   783 GLGCQEICPACEHGASCNPETGTCLCLPGFV--GSR--CQDTCSAGWYGTGCQIRCACANDGHC- 842

  Fly   223 EP--GKCSCAEGYTRGLRESAALGCQPICI-----PDC--------GYGHC-VRPNECECFPGFQ 271
            :|  |:||||.|:|       .|.||..|.     |||        |:|:| .....|.|..|::
  Rat   843 DPTTGRCSCAPGWT-------GLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAVSGLCLCEAGYE 900

  Fly   272 KRK---------NGITCEGDCYMTCENGFCANKTT--CVCQNGYRYDKNTTTCLP------DC-- 317
            ..:         .|.:||..|  .||:|...:..:  |.|..|:|.......| |      ||  
  Rat   901 GPRCEQSCRQGYYGPSCEQKC--RCEHGAACDHVSGACTCPAGWRGSFCEHAC-PAGFFGLDCDS 962

  Fly   318 ------GDNCD--NGVCISPGN----------------------CRCFKGYVRNRERCEAV---- 348
                  |..||  .|.||.|..                      |.||.|     ..|::|    
  Rat   963 ACNCSAGAPCDAVTGSCICPAGRWGPRCAQSCPPLTFGLNCSQICTCFNG-----ASCDSVTGQC 1022

  Fly   349 ----------CVGGC--GFYGK-----CIAPNVCGCAIVPG----PER-TYQRCEY--------- 382
                      |:..|  |.|||     |:..|...|..:.|    ||. |...||.         
  Rat  1023 HCAPGWMGPTCLQACPPGLYGKNCQHSCLCRNGGRCDPILGQCTCPEGWTGLACENECLPGHYAA 1087

  Fly   383 -----------GLCNAM-GRCRCQVGMTRFIDRCMS 406
                       |:|:.: |.|.|..|.|.  |:|.|
  Rat  1088 GCQLNCSCLHGGICDRLTGHCLCPAGWTG--DKCQS 1121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Megf6NP_075244.1 EMI 42..112 CDD:284877
FXa_inhibition 127..162 CDD:291342
vWFA <154..202 CDD:294047
vWFA <237..285 CDD:294047
vWFA <284..325 CDD:294047
FXa_inhibition 338..373 CDD:291342
vWFA <371..410 CDD:294047
vWFA <413..452 CDD:294047
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1555..1574
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.