DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and pear1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_700533.4 Gene:pear1 / 571812 ZFINID:ZDB-GENE-091230-1 Length:1020 Species:Danio rerio


Alignment Length:423 Identity:107/423 - (25%)
Similarity:130/423 - (30%) Gaps:164/423 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVI-EVCCKGW-------------- 129
            |||......|:.|     :::..:...||   .|...|:..:. |.|.:.|              
Zfish    19 LSLSLDPRDPNVC-----SLWESFTTSVK---ESYAQPFDQMSEEPCSEPWSANKCTRHRITYKT 75

  Fly   130 -----------RRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPH 183
                       |||     ||.|         ||              ...||.|||.|...|.|
Zfish    76 LYRQVVKMDYRRRY-----QCCP---------GF--------------YESRNKCVPRCTKECVH 112

  Fly   184 GRCYLNGTCQCDKGYELDGSRKFCQ-----PQCNATC---GHNEVCLEPGKCSCAEGYT------ 234
            |||.....|||:.|:..|.....|.     |.|...|   ...|..:..|.|.|..|||      
Zfish   113 GRCVAPDRCQCEMGWRGDDCSSSCDGQHWGPGCRRLCECQNGGECDVLTGNCQCPAGYTGQHCHD 177

  Fly   235 --------RGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDC-------- 283
                    :|.|:....|...||....|        ||.|..||    .|..||..|        
Zfish   178 PCPVKWFGQGCRQECQCGTGGICNQTTG--------ECVCKQGF----TGTLCEESCPRPKRCAA 230

  Fly   284 YMTCEN-GFCANKTTCVCQNGYRYDKNTTTCLP---------DC----GDNCDNGVCISPGNCRC 334
            ...|:| |.|.....|:|..|:.....|..|.|         ||    |.:||.    ..|.|:|
Zfish   231 RCPCQNGGICQGNGVCLCPPGWMGPVCTERCPPGRFGINCSKDCLCHNGGHCDQ----EKGQCQC 291

  Fly   335 FKGYVRNRERCEAVCVGGCGFYGK-CIAPNVC-------------GCAIVPG-----------PE 374
            ..||  ..|||...|  ..|.||: |  ..||             ||...||           ||
Zfish   292 DAGY--TGERCNEEC--PVGTYGEDC--KGVCDCANGARCYNIHGGCLCEPGFKGPRCDHRMCPE 350

  Fly   375 RTY-QRCEYG-LCNAM---------GRCRCQVG 396
            ..: ..|::. |||.:         |.|.||.|
Zfish   351 AVFGMHCQHRCLCNPLNTLSCHPLKGECTCQPG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
pear1XP_700533.4 EMI 29..96 CDD:284877 16/102 (16%)
Laminin_EGF 411..451 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.