DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Dkk2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_006501881.1 Gene:Dkk2 / 56811 MGIID:1890663 Length:272 Species:Mus musculus


Alignment Length:235 Identity:52/235 - (22%)
Similarity:75/235 - (31%) Gaps:81/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDC 143
            |.||.:.|..|....|...|.....|||.: ||....:|:..  ...|...||.:          
Mouse    69 GKSLGQVGNPPKHTLQPGEAYPCSSDKECE-VGRYCHSPHQG--SSACMLCRRKK---------- 120

  Fly   144 GERCQENGFCVAGGKC---VCF--TDFVL------------------NYRNNCVPTCPLGCPHGR 185
             :||..:|.|..|.:|   :|.  |:.:|                  :|.|:.:....||.||.:
Mouse   121 -KRCHRDGMCCPGTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSK 184

  Fly   186 -----------CYLNGTCQCDKGYELDG---SRKFCQPQCNATCGHNEVCLEPGK---------- 226
                       |..:..|       :||   :|.|....|.......|||.:..|          
Mouse   185 MPHIKGHEGDPCLRSSDC-------IDGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQ 242

  Fly   227 -CSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECE 265
             |.||:|          |.|:  ...|..|....|.:.|:
Mouse   243 RCDCAKG----------LSCK--VWKDATYSSKARLHVCQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:368068 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.