DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and megf10

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_001922524.2 Gene:megf10 / 564571 ZFINID:ZDB-GENE-080506-1 Length:1120 Species:Danio rerio


Alignment Length:341 Identity:101/341 - (29%)
Similarity:123/341 - (36%) Gaps:123/341 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELD 201
            |||.|         ||..:|              :.|||.|...|.||||....||||:.|:...
Zfish    89 SQCCP---------GFYESG--------------DICVPHCAEKCVHGRCVAPNTCQCEPGWGGA 130

  Fly   202 GSRKFCQ-----PQCNATCG-HNEVCLEP--GKCSCAEGYTRGLRESAALGCQPICIPDCGYGH- 257
            .....|.     |.|::.|. .||....|  |.|.||.|| .|.|      |:.:| ....||: 
Zfish   131 DCSSACDRDHWGPHCSSRCQCKNEALCNPITGACICAPGY-HGWR------CEDLC-DHSTYGNN 187

  Fly   258 ----CVRPN---------ECECFPGF---------QKRKNGITCEGDCYMTCENGFCANKTT--C 298
                |:..|         ||.|.||:         ...|:|..||..|  .|:||...:..|  |
Zfish   188 CQQKCLCQNNATCHHITGECVCSPGYTGAFCEDLCPPGKHGQQCEERC--PCQNGGVCHHVTGEC 250

  Fly   299 VCQNGY------------RYDKNTTTCLPDCGDNCDNGVCISP--GNCRCFKGYVRNRERCEAVC 349
            .|..|:            |:.||   |..:|  .|.||...||  |.|.|..||  ..|||:..|
Zfish   251 SCPAGWMGMVCGQPCPTGRFGKN---CSQEC--QCHNGGICSPSTGQCVCSSGY--TGERCQDQC 308

  Fly   350 -VG----GCGFYGKCIAPNVCGCAIVPGP---ERTY--QRCE--------YGL-------CNA-- 387
             ||    ||....:|:  |...|..|.|.   |:.|  :.||        |||       ||.  
Zfish   309 QVGTYGIGCSQACRCV--NGAQCYHVSGACLCEQGYTGESCEERICPDGQYGLKCDRKCPCNTNN 371

  Fly   388 -------MGRCRCQVG 396
                   .|.|.||.|
Zfish   372 TRSCHPMSGECSCQSG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
megf10XP_001922524.2 EMI 29..96 CDD:284877 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.