DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and megf6b

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_009304569.1 Gene:megf6b / 557764 ZFINID:ZDB-GENE-101112-3 Length:1589 Species:Danio rerio


Alignment Length:423 Identity:111/423 - (26%)
Similarity:143/423 - (33%) Gaps:161/423 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KCRQEVPAVFFQYDKEVKIV--GNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGF- 152
            :|.|..||.:|........|  .|||.:......| |..||..         ..|.:||....| 
Zfish  1014 RCNQTCPAGWFGVSCSQTCVCHNNSSCDAVSGQCE-CGAGWTG---------DTCSQRCPAGVFG 1068

  Fly   153 --CVAGGKCVCFTDFVLNYRN--NCVP--------------TCPLGCPHGR----CYLNGTCQCD 195
              ||  .:|:|        :|  :|.|              .|.|.||.||    |  ...|:|.
Zfish  1069 DGCV--HRCLC--------QNGASCDPESGHCFCPSGWTGAACQLECPAGRFGSDC--QDRCECV 1121

  Fly   196 KGYELDG--SRKFCQP---------QC-----------NATCGHNEVCLE-PGKCSCAEGYTRGL 237
            .|.:.||  .|..|.|         :|           ...|.|..||.. .|:|.|..|: ||.
Zfish  1122 NGAQCDGQTGRCVCPPGWTGERCENECERGWFGVGCEDRCQCDHGAVCHHVSGQCLCPAGW-RGR 1185

  Fly   238 RESAALGCQPICIP-----DCGYGHCVRPN---------ECECFPGFQKRKNGITCE-------- 280
            |      |:..|:|     || ...|..|:         .|.|.|||    .|..||        
Zfish  1186 R------CEKACLPGSFGQDC-VQRCSCPSGSSCHHVTGHCGCAPGF----TGDGCEHSCLPGTF 1239

  Fly   281 -GDCYMTCE----NGFCANKT-TCVCQNGYRYDKNTTTCLPD------CGDNCD---NGVCIS-P 329
             .||...|:    |..|...| .|.|..|:...|...|| |.      |...|:   .|||:| .
Zfish  1240 GQDCNQVCQCSERNQLCHPVTGVCYCAPGFTGLKCEQTC-PQGLYGSGCEHQCECLNGGVCLSDS 1303

  Fly   330 GNCRCFKGYVRNRERCEAVC-----------VGGCG-------FYGKCIAPNVC-------GCAI 369
            |:|:|..|::  ..:|...|           |..||       ..|:|.|..||       ||: 
Zfish  1304 GSCQCPAGFI--GAQCNQTCPAGRYGLDCAHVSACGTGVRNDPATGRCTAHQVCPPGWFGSGCS- 1365

  Fly   370 VPGPERTYQRCE---YGLCNAM-GRCRCQVGMT 398
                    |||:   .|:|:.: |.|.|.:|.|
Zfish  1366 --------QRCDCSNRGVCDGVSGNCSCALGWT 1390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
megf6bXP_009304569.1 EMI 33..102 CDD:284877
FXa_inhibition 152..187 CDD:291342
vWFA <184..227 CDD:294047
FXa_inhibition 234..270 CDD:291342
FXa_inhibition 276..311 CDD:291342
vWFA <308..350 CDD:294047
FXa_inhibition 363..398 CDD:291342
vWFA <396..436 CDD:294047
FXa_inhibition 445..480 CDD:291342
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.