DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and NimC3

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_524928.2 Gene:NimC3 / 48772 FlyBaseID:FBgn0001967 Length:224 Species:Drosophila melanogaster


Alignment Length:137 Identity:39/137 - (28%)
Similarity:55/137 - (40%) Gaps:30/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 CPHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAA--L 243
            ||..|..|.|               ||:|.|...|..:..|.||.:|.|..||......:..  |
  Fly    82 CPGYRTILFG---------------FCEPVCQEACPAHSYCAEPDRCHCQRGYEPSHHHTTGHQL 131

  Fly   244 GCQPICIPDC-GYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYD 307
            .|:|:|...| .:.|||..|||||:|||:...:..:..    :.||...|.::        .|:|
  Fly   132 ICRPVCQGGCPEHSHCVAHNECECWPGFKDASSWFSLS----LRCERVQCGHE--------QRFD 184

  Fly   308 KNTTTCL 314
            .....|:
  Fly   185 PGRRACV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
NimC3NP_524928.2 MSC 85..>212 CDD:286487 37/134 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.