DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and NimB3

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:109 Identity:35/109 - (32%)
Similarity:48/109 - (44%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CGYGHCVRPNECECF----PGFQKRKNGITCEGD--CYMTCE----NGFCANKTTCVCQNGYRYD 307
            ||.|..:.......|    |..|.||..:...|.  ||.|..    |....|:....|.:|| .:
  Fly    13 CGLGIELPTRTAAQFWSVDPVTQWRKEALAERGSGICYRTLTVETINPNSRNRQFSYCCDGY-VN 76

  Fly   308 KNTT---TCLPDCGDNCDNGVCISPGNCRCFKGYVRNRERCEAV 348
            |.|:   .|.|.|.::|.||:|::|..|.|..||.|:.:||..|
  Fly    77 KGTSQNLKCEPICSEDCSNGLCLAPEECECAPGYYRSNKRCRFV 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.