DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and drpr

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster


Alignment Length:470 Identity:118/470 - (25%)
Similarity:168/470 - (35%) Gaps:146/470 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVLFLCVLHGLELQLHEQQLQQQKDEQLRLRAEQRQRELL-REHEALQRRLSSSTTTRKPYIIPN 78
            ::|..|:   .:|.|.:..|:......:..|.|....::: .|.::.|.|.|:...|        
  Fly     4 VILIACL---AQLVLAQADLKDLDGPNICKRRELYNVDVVYTELQSFQERGSTWCVT-------- 57

  Fly    79 GLSLPRRGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDC 143
                     .|.:|.        .|..:.::|..:.|.....::..||.|   |.....:|||.|
  Fly    58 ---------FPPRCS--------TYRIKHRVVNKTKTIAKNRIVRDCCDG---YIASAGECVPHC 102

  Fly   144 GERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQ 208
            .|.|| :|.|::..||.|...:       ..|.|.:.||.|....|.:.|||             
  Fly   103 SEPCQ-HGRCISPEKCKCDHGY-------GGPACDINCPPGWYGRNCSMQCD------------- 146

  Fly   209 PQCNATCGHNEVCLEP--GKCSCAEGYTRGLRESAALGCQPICIPDCGYG--------------- 256
                  |.:|.|| ||  |.|.||:||| |.|      |..|| |:..:|               
  Fly   147 ------CLNNAVC-EPFSGDCECAKGYT-GAR------CADIC-PEGFFGANCSEKCRCENGGKC 196

  Fly   257 HCVRPNECECFPGF---------QKRKNGITCEGDCYMTCEN-GFCANKT-TCVCQNGYRYDKNT 310
            |.| ..||:|.|||         ...|:|..|:.||  .|:| |.|..:| .|:|..|:..|...
  Fly   197 HHV-SGECQCAPGFTGPLCDMRCPDGKHGAQCQQDC--PCQNDGKCQPETGACMCNPGWTGDVCA 258

  Fly   311 TTCL-----PDCGDNCDNGVCIS-------PGNCRCFKGYVRNR--ERCEAVCVG-GCGFYGKCI 360
            ..|.     |.|.::|:   |..       .|.|.|..||...|  :.|:....| .|.....|.
  Fly   259 NKCPVGSYGPGCQESCE---CYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCA 320

  Fly   361 APNVCG-----CAIVPG------PERTYQRCEYGL-CN---------------AMGRCRCQVGMT 398
            ...:|.     |...||      .||..:..:||| ||               ..|.|:|.:|.:
  Fly   321 NDAMCDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWS 385

  Fly   399 RFIDRCMSPDTVTTY 413
            .  .:|..|.|...|
  Fly   386 S--AQCTRPCTFLRY 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
drprNP_001261276.1 EMI 27..92 CDD:284877 15/92 (16%)
EGF_CA 274..319 CDD:304395 11/47 (23%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.