DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Scarf1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001004157.2 Gene:Scarf1 / 380713 MGIID:2449455 Length:820 Species:Mus musculus


Alignment Length:374 Identity:97/374 - (25%)
Similarity:129/374 - (34%) Gaps:142/374 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CCKGWRRYEYDWSQC-VPDC--GERCQENGFCVAGGKCVCFTDFV----------LNYRNNCVPT 176
            ||.|||:.:   .:| :|.|  .:.|::...||..|.|.|...|.          ..:.::|..|
Mouse    44 CCPGWRQKD---QECTIPICEGPDACRKEEVCVKPGLCRCKPGFFGAQCSSRCPGQYWGHDCRET 105

  Fly   177 CPLGC-PHGRCY-LNGTCQCDKGYELDGSRKFCQPQCNATCG-HNE-----------------VC 221
            ||  | |.|:|. ..|.|||...|    ..:.|:..|  ||| |.:                 .|
Mouse   106 CP--CHPRGQCEPATGDCQCQPNY----WGRLCEFPC--TCGPHGQCDPKTGLCHCDPGWWSPTC 162

  Fly   222 LEP-------------GKCSCAEGYTRGLRESAALGCQP----------ICIP-----------D 252
            ..|             |.|.|..|:. |.|.|.:..|..          :|:|           .
Mouse   163 RRPCQCNPASRCDQATGTCVCPPGWW-GRRCSFSCNCHTSPCMQDSGRCVCLPGWWGPECSRKCQ 226

  Fly   253 CGYGHC-VRPNECECFPGFQKRKNGITCE---------GDCYMTCENGFCANKTTC--------V 299
            |..|.| |....|.|.|||    :||.||         ..|..:|  |.|....||        .
Mouse   227 CVRGQCSVTSGHCSCPPGF----HGIRCELPCNPGHYGAQCKESC--GHCELNATCSPVTGNCES 285

  Fly   300 CQNGYRYDKNTTTCLPDC-----GDNCDNGVC----------ISPGNCR-CFKGYVRNRERCEAV 348
            |:.|:    |.|.|...|     |:.| .|.|          ...|:|: |..|::.:  |||..
Mouse   286 CKPGW----NGTQCKQPCPAGTFGERC-TGQCPRCRLGEPCQAETGHCQHCDPGWLGH--RCENP 343

  Fly   349 CVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAM-GRCRCQVG 396
            |  ..|.:||       ||:      .|...|..|.|:|: |.|.|..|
Mouse   344 C--PLGTFGK-------GCS------STCPACAQGTCDAVTGECVCSAG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Scarf1NP_001004157.2 PHA03247 <541..781 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 549..685
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..820
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.