DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and PEAR1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens


Alignment Length:369 Identity:96/369 - (26%)
Similarity:125/369 - (33%) Gaps:153/369 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 RNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQ-----PQCN--ATCGHNEVCLEP--G 225
            |..|||.|...|.||||.....|||..|:..|.....|.     |||:  .:||:|..| :|  |
Human   186 RGFCVPLCAQECVHGRCVAPNQCQCVPGWRGDDCSSECAPGMWGPQCDKPCSCGNNSSC-DPKSG 249

  Fly   226 KCSCAEGYTRGLRESAALGCQPICIPDC--GYGHCVRPNECECFPGFQKRKNGITCE---GDCY- 284
            .|||..|..           .|.|:..|  ||........|:|        :|..|:   |.|: 
Human   250 VCSCPSGLQ-----------PPNCLQPCTPGYYGPACQFRCQC--------HGAPCDPQTGACFC 295

  Fly   285 ----------MTCENG----FCANKTTCVCQNG--YRYDKNTTTCL------------------P 315
                      ::|..|    ||  .:|..||||  ::..:.:.:|.                  |
Human   296 PAERTGPSCDVSCSQGTSGFFC--PSTHSCQNGGVFQTPQGSCSCPPGWMGTICSLPCPEGFHGP 358

  Fly   316 DCGDNC---DNGVCIS-PGNCRCFKGYV--RNRERC-----------------EAVCV---GGC- 353
            :|...|   :.|:|.. .|.|||..||.  |.||.|                 :|.|.   |.| 
Human   359 NCSQECRCHNGGLCDRFTGQCRCAPGYTGDRCREECPVGRFGQDCAETCDCAPDARCFPANGACL 423

  Fly   354 -----------------GFYG-KCIAPNVCG-------------CAIVPG----------PERTY 377
                             |||| .|.||..|.             |:.:||          |:.|:
Human   424 CEHGFTGDRCTDRLCPDGFYGLSCQAPCTCDREHSLSCHPMNGECSCLPGWAGLHCNESCPQDTH 488

  Fly   378 -----QRC---EYGLCNA-MGRCRCQVGMTRFIDRCMS---PDT 409
                 :.|   ..|:|.| .|.|:|..|.|.  ..|.|   |||
Human   489 GPGCQEHCLCLHGGVCQATSGLCQCAPGYTG--PHCASLCPPDT 530



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.