DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and CG11674

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:324 Identity:76/324 - (23%)
Similarity:110/324 - (33%) Gaps:92/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 IVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNC 173
            :.|..:|....:::|:.|..      | :||..      .|.|.|| ...|:| |......|..|
  Fly    12 LAGFLATGRAEDLLELSCSS------D-AQCAQ------FERGRCV-DMACIC-TARGSGERVPC 61

  Fly   174 VP-------------TCPLGCPHGRCYLN-GTCQCDKGYELDGSRKFCQPQCNATCGHNEVCLEP 224
            .|             .||...|:..|:.. ..|.|.:|:.....|:.|.|         .|....
  Fly    62 TPLEERLKLTNIIGGACPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLP---------AVVPVG 117

  Fly   225 GKCSCAEGYTRGLRESAALGCQPICIPDCGY--GHCVRPNECECFPGFQKRKNGITCEGDCYMTC 287
            |.|...:...|..|.|:.:|.|.:|:....:  |.|:...:..|..           :.|| .:|
  Fly   118 GSCEFQQQCQRADRFSSCIGNQCLCLNQFEFHEGRCLSVLQSSCLE-----------DKDC-GSC 170

  Fly   288 ENGFCANKT-TCVCQNGYRYDKNTTTCLPDC--GDNCDNGVCISPGNCRCFKGYVRNRERC-EAV 348
            ....|..|| .|.|...:.::.|.|.|:...  ||.|::.   ||  |:...|   ...|| :.:
  Fly   171 GASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYGDTCEHS---SP--CKLNLG---ADGRCLDHL 227

  Fly   349 CVGGCGFYGKCIAPNVC----------------GCA-IVPGPERTYQRCEYG-LCNAMGRCRCQ 394
            ||.....|.|.:|..|.                .|| |||          :| ||.....||.|
  Fly   228 CVCRSTHYPKRVANEVAKDENDDLDAVNNLERITCAPIVP----------FGALCRNDSECRMQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.