DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Ccbe1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:352 Identity:72/352 - (20%)
Similarity:98/352 - (27%) Gaps:159/352 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RLRAEQRQRELLREHEALQRRLSSSTTTRKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYDKEV 107
            |...|.|.||:..|::.        |||:.|.:..:|               |:...|       
Mouse    37 REEPEDRDREVCSENKI--------TTTKYPCLKSSG---------------ELTTCF------- 71

  Fly   108 KIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPD---------CGERCQENGFCVAGGKCVCFT 163
                          .:.||||   |::...||:|:         |.::|.:|             
Mouse    72 --------------RKKCCKG---YKFVLGQCIPEDYDICAQAPCEQQCTDN------------- 106

  Fly   164 DFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQPQCNATCGHNE----VCLEP 224
                               .||.    .|.|..||..|..|            |.:    .||:.
Mouse   107 -------------------FGRV----LCTCYPGYRYDRER------------HQKRERPYCLDI 136

  Fly   225 GKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITC-EGDCYMT-- 286
            .:|:          .|....|..|||...|..|      |||..|:....:|.|| .||.|..  
Mouse   137 DECA----------TSNTTLCAHICINTMGSYH------CECREGYILEDDGRTCTRGDKYPNDT 185

  Fly   287 -----CENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGYVRNRERCE 346
                 .||...|. |.|.....:...|.|...|       ...:.:.|.|......||..     
Mouse   186 GHEEKSENEVKAG-TCCATCKEFSQMKQTVLQL-------KQKMALLPNNAAELGKYVNG----- 237

  Fly   347 AVCVGGCGFYGKCIAPNVCGCAIVPGP 373
                      .|.:|.|    |.:|||
Mouse   238 ----------DKVLASN----AYLPGP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 14/56 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335 3/5 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.