DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Dlk2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_017451911.1 Gene:Dlk2 / 316232 RGDID:1309143 Length:405 Species:Rattus norvegicus


Alignment Length:238 Identity:68/238 - (28%)
Similarity:89/238 - (37%) Gaps:46/238 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DCGERCQ-ENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRK 205
            ||...|. .:|.|...|.|.|...:...:...|| ..| ||.||.|:....|.|..|:    :.|
  Rat    51 DCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCV-RMP-GCQHGTCHQPWQCICHSGW----AGK 109

  Fly   206 FCQPQ---C--NATCGHNEVCLEPG----KCSCAEGYT-RGLRESAALGCQPICIPDCGYGHCVR 260
            ||...   |  .:.|.:...|:..|    .|.|..|:. ||....|. .|:....|....|.| :
  Rat   110 FCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFRGRGCERKAG-PCEQAGFPCQNGGQC-Q 172

  Fly   261 PNE-------CECFPGFQKRKNGITCE---GDCYM-TCENGFCA----NKTTCVCQNGYRYDKNT 310
            .|:       |.|..||.    |..||   .||.| .|.||...    |:.:|:|..|:. .:..
  Rat   173 DNQGFALNFTCRCLAGFM----GAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFA-GRFC 232

  Fly   311 TTCLPDCGDN-CDNGV-C---ISPGNCRCFKGYVRNRERCEAV 348
            |..|.||... |..|. |   :...:|.|..||  ..:.||.|
  Rat   233 TINLDDCASRPCQRGARCRDRVHDFDCLCPSGY--GGKTCELV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Dlk2XP_017451911.1 EGF_CA 112..152 CDD:238011 9/39 (23%)
EGF_CA <164..195 CDD:238011 9/35 (26%)
EGF_CA 197..233 CDD:238011 10/36 (28%)
EGF_CA 235..271 CDD:238011 10/37 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.