DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Pear1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001128431.1 Gene:Pear1 / 295293 RGDID:1305653 Length:1033 Species:Rattus norvegicus


Alignment Length:404 Identity:108/404 - (26%)
Similarity:140/404 - (34%) Gaps:145/404 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SSSTTTR----KPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQ--YDKEVKIVGNSSTNPYMNVIE 123
            |.:|||:    :|:.:|...|..|..|.|..|.|  |.|.::  |.:.||:    .:.|.:.   
  Rat    32 SFTTTTKESHLRPFSLPPAESCDRPWEDPHTCAQ--PMVVYRTVYRQVVKM----DSRPRLQ--- 87

  Fly   124 VCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYL 188
             ||.|:  ||...:                                   |||.|...|.||||..
  Rat    88 -CCGGY--YESSGA-----------------------------------CVPLCAQECVHGRCVA 114

  Fly   189 NGTCQCDKGYELDGSRKFCQ-----PQCN--ATCGHNEVCLEP--GKCSCAEGYTRGLRESAALG 244
            ...|||..|:..|.....|.     |||:  ..||::..| :|  |.|.|..|..          
  Rat   115 PNRCQCAPGWRGDDCSSECAPGMWGPQCDRLCLCGNSSSC-DPRSGVCFCPSGLQ---------- 168

  Fly   245 CQPICI---PDCGYG-------HCV------RPNECECFPGFQKRKNGITCEGDCYMTCENGFCA 293
             .|.|:   ||..||       ||.      |...|.|.||    :.|.:|...|....:..||.
  Rat   169 -PPDCLQPCPDGHYGPACQFDCHCYGASCDPRDGACFCPPG----RTGPSCNVPCSQGTDGFFCP 228

  Fly   294 NKTTCVCQNGYRYDKNTTTCL--------------------PDCGDNC---DNGVCIS-PGNCRC 334
            .  |..||||.....:..:|.                    |:|...|   :.|:|.. .|.|.|
  Rat   229 R--TYPCQNGGVPQGSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQECRCHNGGLCDRFTGQCHC 291

  Fly   335 FKGYV--RNRERCEAVCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQVGM 397
            ..||:  |.||.|..      |.:|:..| ..|.||  ||     .||    ..|.|.|.|:.|.
  Rat   292 APGYIGDRCREECPV------GRFGQDCA-ETCDCA--PG-----ARC----FPANGACLCEHGF 338

  Fly   398 TRFIDRC---MSPD 408
            |.  |||   :.||
  Rat   339 TG--DRCTERLCPD 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Pear1NP_001128431.1 EMI 25..93 CDD:284877 21/72 (29%)
EGF_CA 535..580 CDD:304395
Laminin_EGF 620..665 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.