DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Scarf2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_038944006.1 Gene:Scarf2 / 287949 RGDID:1306013 Length:838 Species:Rattus norvegicus


Alignment Length:388 Identity:97/388 - (25%)
Similarity:123/388 - (31%) Gaps:144/388 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 NSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPT 176
            |....|...|: .||.|||:...:....|.:....|.||..||..|:|.|...:   :..||...
  Rat    44 NVCRTPGSQVL-TCCAGWRQLGDECGIAVCEGNSTCSENEVCVRPGECRCRHGY---FGANCDTK 104

  Fly   177 CP-----------------------------------------LGCPHGRCY-LNGTCQCDKG-- 197
            ||                                         ..|.||.|: .:|.|:|:.|  
  Rat   105 CPRQFWGPDCKERCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW 169

  Fly   198 --------YELDGSRKFCQPQ--------------CNATCGHNEVCLE--PGKCSCAEGYTRGLR 238
                    |....||  |.||              ||..|..|....|  .|:|.|.| .|.|.|
  Rat   170 GAQCASACYCSATSR--CDPQTGACLCHAGWWGRSCNNQCSCNSSPCEQQSGRCQCRE-RTFGAR 231

  Fly   239 ESAALGCQPICIPDCGYGHCVRP--NECECFPGFQKRK---------NGITC------------- 279
                  |...|  .|..|.| .|  ..|.|.||::.:.         .|:.|             
  Rat   232 ------CDRYC--QCFRGRC-HPVDGTCACDPGYRGKYCREPCPAGFYGLGCRRRCGQCKGQQPC 287

  Fly   280 ---EGDCYMTCENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNC----DNGVCIS-PGNC-RCF 335
               ||.| :|||.|:...|....|..|: |.:.       ||..|    |...|.. .|.| .|.
  Rat   288 TVVEGRC-LTCEPGWNGTKCDQPCATGF-YGEG-------CGHRCPPCRDGHACNHVTGKCTHCN 343

  Fly   336 KGYVRNRERCEAVCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCN-AMGRCRCQVGM 397
            .|::  .:|||..|..|.  ||:       .||.|      ...|..|.|: ..|||.|..|:
  Rat   344 AGWI--GDRCETKCSNGT--YGE-------DCAFV------CSDCGSGHCDFQSGRCLCSPGV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Scarf2XP_038944006.1 exchanger_TraA <74..431 CDD:411343 88/357 (25%)
PHA03247 <683..837 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.