DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and DKK3

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001317149.1 Gene:DKK3 / 27122 HGNCID:2893 Length:364 Species:Homo sapiens


Alignment Length:226 Identity:42/226 - (18%)
Similarity:63/226 - (27%) Gaps:88/226 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 LGCPHGR----CYLNGTCQCDKGYELDGSRKFC-----QPQCNATCGHNEVCLEPGKCSCAEGYT 234
            :|...||    |.::..|         |...:|     |..|....|...:|....:| |.:   
Human   136 VGDEEGRRSHECIIDEDC---------GPSMYCQFASFQYTCQPCRGQRMLCTRDSEC-CGD--- 187

  Fly   235 RGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCV 299
                        .:|:    :|||.:.        ..:..||..|  |....|:.|.|     |.
Human   188 ------------QLCV----WGHCTKM--------ATRGSNGTIC--DNQRDCQPGLC-----CA 221

  Fly   300 CQNGYRYDKNTTTCLPDCGDNCDNGVC---------ISP----GNCRCFKGYVRNRER------- 344
            .|.|..:.  ..|.||..|:.|.:...         :.|    ..|.|..|.:....|       
Human   222 FQRGLLFP--VCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHRLPRLEPG 284

  Fly   345 -------------CEAVCVGGCGFYGKCIAP 362
                         |:...||.....|:.:.|
Human   285 FVPSLPSHSLVYVCKPTFVGSRDQDGEILLP 315



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.