DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and DKK4

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_055235.1 Gene:DKK4 / 27121 HGNCID:2894 Length:224 Species:Homo sapiens


Alignment Length:195 Identity:47/195 - (24%)
Similarity:66/195 - (33%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 ELDGSRKFCQPQCNATCGHNEVCLEPGK----CSCAEGYTRGLRESAALGCQP--ICIPD-C--- 253
            :|.|:||..|...:..|...:.||:|..    |:...|..|..:..|.  |.|  :|:.| |   
Human    31 DLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAM--CCPGTLCVNDVCTTM 93

  Fly   254 ---------------------GYGHCVRPNECECFPGFQKRKNGITCEGD-CYMT--CENGFCAN 294
                                 ..||.|:.|:.:..|..:|.:.....||: |..|  |..|.|..
Human    94 EDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCA 158

  Fly   295 K--TTCVC-------QNGYRYDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGYVRNRERCE-AVC 349
            :  .|.:|       |...|.....|...|:....||.|    || ..|......||:... .||
Human   159 RHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCG----PG-LLCRSQLTSNRQHARLRVC 218

  Fly   350  349
            Human   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
DKK4NP_055235.1 Dickkopf_N 41..91 CDD:309719 12/51 (24%)
DKK-type Cys-1 41..90 12/50 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 109..139 6/29 (21%)
DKK-type Cys-2 145..218 19/77 (25%)
Prokineticin <145..202 CDD:148298 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.