DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and NimB2

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:307 Identity:113/307 - (36%)
Similarity:152/307 - (49%) Gaps:26/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAG 156
            |.:|||......:...:.|||.:| |.|:.|:|||.|:.|..:.:.:|.|.|.:.|: ||.|.|.
  Fly   135 CYKEVPTASLLRNSRDQFVGNGTT-PDMSRIQVCCDGYERNPHIYRRCEPICADDCR-NGICTAP 197

  Fly   157 GKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELD-GSRKFCQPQCNATCGHNEV 220
            ..|||....|......|:.||||||.:|.|.....|:|.:||.|: .:||:|||:|...|.... 
  Fly   198 NTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPECKPGCSFGR- 261

  Fly   221 CLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRKNGITCEGDCYM 285
            |:.|.||:|.:||    |.:|...|:|:| ..|..|.|..|..|.|..|:.|.:.  .||..|.:
  Fly   262 CVAPNKCACLDGY----RLAADGSCEPVC-DSCENGKCTAPGHCNCNAGYLKLQG--RCEPICSI 319

  Fly   286 TCENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGYVRN---RERCEA 347
            .|:||.|.....|.|.:|:.:|:.:..|||.|...|.||||:....|.|..||||:   |..|:.
  Fly   320 PCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNICQP 384

  Fly   348 VCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQ 394
            .|..||. .|.|.|||.|.|.  ||         :......||..||
  Fly   385 HCPQGCQ-NGYCSAPNFCICR--PG---------FIKSGIKGRQTCQ 419



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.