DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and STAB1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:433 Identity:99/433 - (22%)
Similarity:148/433 - (34%) Gaps:145/433 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LREH-EALQRRLSSST-------------TTRKPYIIPNGLSLPRRGEHPDKCRQEVPAVFFQYD 104
            |..| |||:.:..:.|             |.||..:..:|.|..|...:....:.:||.      
Human  1261 LHSHAEALREKCVNCTRRFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPD------ 1319

  Fly   105 KEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDC----GERCQENGFC----VAGGKCVC 161
                                ||.|     :..:.|.| |    |..|..:|.|    :..|:|.|
Human  1320 --------------------CCPG-----FFGTLCEP-CPGGLGGVCSGHGQCQDRFLGSGECHC 1358

  Fly   162 FTDF---------VLNYRNNCVPTCPLGCPHGRCYL----NGTCQCDKGYE-LDGSRKFCQPQCN 212
            ...|         :..|..||...|  .|.||.|..    :|:|.|:.|:: |...:|...|||.
Human  1359 HEGFHGTACEVCELGRYGPNCTGVC--DCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCP 1421

  Fly   213 ATCGHNEVCLE----PGKCSCAEGYTRGLRESAALGCQPIC--IPDCGYGHCVRPNECECFPGFQ 271
            ..|..|..|::    ...|:||.||:         |....|  :..|.:||              
Human  1422 RKCDPNANCVQDSAGASTCACAAGYS---------GNGIFCSEVDPCAHGH-------------- 1463

  Fly   272 KRKNGITCEGDC--YMTCENGFCANKTTCVCQNGYRYD----KNTTTCLPDCGDNCDNGVCISPG 330
                     |.|  :..|.. ....:.||.||:||..|    :...:||...|....:..||..|
Human  1464 ---------GGCSPHANCTK-VAPGQRTCTCQDGYMGDGELCQEINSCLIHHGGCHIHAECIPTG 1518

  Fly   331 ----NCRCFKGYVRNRER-CEAV--CV---GGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLC 385
                :|.|.:||..:..| ||.:  |.   |||..|..|.:..        ..:||   |.....
Human  1519 PQQVSCSCREGYSGDGIRTCELLDPCSKNNGGCSPYATCKSTG--------DGQRT---CTCDTA 1572

  Fly   386 NAMG---RCRCQVGMTRFIDRCMSPDTVTTYASMNPVKVNASL 425
            :.:|   .||.:||:....|:..|      :.|:..::::..|
Human  1573 HTVGDGLTCRARVGLELLRDKHAS------FFSLRLLEIHGRL 1609



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.