DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and DKK1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_036374.1 Gene:DKK1 / 22943 HGNCID:2891 Length:266 Species:Homo sapiens


Alignment Length:250 Identity:47/250 - (18%)
Similarity:69/250 - (27%) Gaps:65/250 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 HPDKCRQEVPAVFFQYDKEVKIVGNSSTNPY-------MNVIEVCCKGWRRYEYDWSQCVPDC-- 143
            ||.......|.:.:....:.:.:.|  ..||       ....|.|....|..:.....|:. |  
Human    55 HPGSAVSAAPGILYPGGNKYQTIDN--YQPYPCAEDEECGTDEYCASPTRGGDAGVQICLA-CRK 116

  Fly   144 -GERCQENGFCVAGGKC---VCFTDFVLNYRNNCVPTC--PLGCPHGRC--YLNGTCQCDKGYEL 200
             .:||..:..|..|..|   :|.:....::|.....|.  ..|..|...  |...|....|.|..
Human   117 RRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHT 181

  Fly   201 DGSRKFCQPQCNATCGHNEVCLEPGKCS----CAEGYTRGLRESAALGCQPICIPDCGYGHCVRP 261
            .|.             ...|||....|:    ||..:           ...||.|....|..   
Human   182 KGQ-------------EGSVCLRSSDCASGLCCARHF-----------WSKICKPVLKEGQV--- 219

  Fly   262 NECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTT---TC 313
                |....:|..:|:.....||       |....:|..|..:....|::   ||
Human   220 ----CTKHRRKGSHGLEIFQRCY-------CGEGLSCRIQKDHHQASNSSRLHTC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
DKK1NP_036374.1 Dickkopf_N 85..139 CDD:309719 10/54 (19%)
DKK-type Cys-1 85..138 10/53 (19%)
DKK-type Cys-2 189..263 18/98 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.