DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Dner

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_690879.1 Gene:Dner / 227325 MGIID:2152889 Length:737 Species:Mus musculus


Alignment Length:336 Identity:82/336 - (24%)
Similarity:116/336 - (34%) Gaps:87/336 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 VPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCK----GWRRYEYDWSQCVPDCGERCQENGFCVAG 156
            ||......|.|....|..:|.|........|:    |....|:|..|..|     ||....|:..
Mouse   308 VPGDSHSNDLECSGKGKCATKPSEATFSCTCQDQYIGTFCEEFDACQRKP-----CQNEASCIDA 367

  Fly   157 GK--------CVCFTDFVLNYRNNCVPTCPLG-CPHG-RCY--LNG-TCQCDKGYELDGSRKFCQ 208
            .:        |:|...:......:.:..|.|. |.:| .|.  |:| ||||.:||......:...
Mouse   368 NEKQDGSNFTCLCLPGYTGELCQSKIDYCVLDPCRNGATCVSSLSGFTCQCLEGYFGSACEEKVD 432

  Fly   209 PQCNATCGHNEVCLEPG---KCSCAEGYTRGLRESAALGCQPIC--------IPDCGYGHCVRPN 262
            |..::.|.:|..|...|   .|||:.|:|           .|.|        :..|.:|.|....
Mouse   433 PCMSSPCQNNGTCYVDGVHFTCSCSPGFT-----------GPTCAQLVDFCALSPCAHGMCRSVG 486

  Fly   263 ---ECECFPGFQKRKNGITCEGDCYMTCENGFCANKTTC-VCQNGYRYDKNTTTCLPD-----C- 317
               :|.|.||:    :|:.||.: |..|.:..|.|..|| ...|||.     ..||.:     | 
Mouse   487 TSYKCLCDPGY----HGLYCEEE-YNECLSAPCLNAATCRDLINGYE-----CVCLAEYKGTHCE 541

  Fly   318 --GDNCDNGVCISPGNCRCFKGYVRNRERCEAVCVGGCGFYGKCIAPNVCGCAIVPGPERTYQRC 380
              .|.|.|..|::.|.|        :.|.....|:...||.|:       .|.|      ....|
Mouse   542 LYKDPCANISCLNGGTC--------DSEGLNGTCICAPGFTGE-------ECDI------DINEC 585

  Fly   381 EYGLCNAMGRC 391
            :...|:..|.|
Mouse   586 DSNPCHHAGTC 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
DnerNP_690879.1 Interaction with NOTCH1. /evidence=ECO:0000269|PubMed:15965470 44..133
EGF_CA 393..428 CDD:238011 13/34 (38%)
EGF_CA 431..465 CDD:238011 11/44 (25%)
EGF_CA 507..541 CDD:238011 10/38 (26%)
EGF_CA 581..617 CDD:238011 4/16 (25%)
Interaction with AP1G1 and somatodendritic targeting. /evidence=ECO:0000269|PubMed:11950833 677..680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4928
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.