DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Megf11

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_006511049.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus


Alignment Length:402 Identity:103/402 - (25%)
Similarity:132/402 - (32%) Gaps:140/402 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCC---------------------KGWRRYEYDWSQ 138
            |.|.|...::.....|..|..:|:..:....|                     :|.|......||
Mouse    22 EDPNVCSHWESYAVTVQESYAHPFDQIYYTRCADILNWFKCTRHRISYKTAYRRGLRTMYRRRSQ 86

  Fly   139 CVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGS 203
            |.|.    ..|||            ||       |:|.|...|.||||....||.|:.|:.....
Mouse    87 CCPG----YYENG------------DF-------CIPLCTEECMHGRCVSPDTCHCEPGWGGPDC 128

  Fly   204 RKFCQ-----PQCNATCG-HNEVCLEP--GKCSCAEGYTRGLR--ESAA-----LGCQPICIPDC 253
            ...|.     |.|:..|. .|.....|  |.|.||.|: ||.|  |..|     .|||.:|  .|
Mouse   129 SSGCDSEHWGPHCSNRCQCQNGALCNPITGACVCAPGF-RGWRCEELCAPGTHGKGCQLLC--QC 190

  Fly   254 GYGHCVRP--NECECFPGFQKRKNGITCEGDC-----------YMTCENGFCANKTT--CVCQNG 303
            .:|....|  .||.|.||:    .|:.||..|           ...|:||...:..|  |.|..|
Mouse   191 HHGASCDPRTGECLCAPGY----TGVYCEELCPPGSHGAHCELRCPCQNGGTCHHITGECACPPG 251

  Fly   304 Y------------RYDKNTTTCLPDC----GDNCDNGVCISPGNCRCFKGYVRNRERCEAVC-VG 351
            :            .:.:|   |..||    |..||:    ..|.|.|..||:  .:||:..| .|
Mouse   252 WTGAVCAQPCPPGTFGQN---CSQDCPCHHGGQCDH----VTGQCHCTAGYM--GDRCQEECPFG 307

  Fly   352 GCGFY----------GKCIAPNVCGCAIVP---GPERTYQRCEYGL------------------C 385
            ..||.          |:| :|....|...|   ||....:.|..||                  |
Mouse   308 TFGFLCSQRCDCHNGGQC-SPATGACECEPGYKGPSCQERLCPEGLHGPGCTLPCPCDTENTISC 371

  Fly   386 NAM-GRCRCQVG 396
            :.: |.|.||.|
Mouse   372 HPVTGACTCQPG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Megf11XP_006511049.1 EMI 25..92 CDD:400092 11/70 (16%)
EGF_CA 188..233 CDD:419698 13/50 (26%)
EGF_CA 274..319 CDD:419698 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.