DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Dkk3

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 / 171548 RGDID:621846 Length:348 Species:Rattus norvegicus


Alignment Length:324 Identity:73/324 - (22%)
Similarity:108/324 - (33%) Gaps:100/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ELQLHE-----QQLQQQKDEQLRLRAEQRQRELLREHEALQRRLSSSTTTRKPYIIPNGLSLPRR 85
            |..|:|     ::|.:....:||...|:.:.|     ||..|..|..|.:..|....|..:...|
  Rat    44 EATLNEMFREVEELMEDTQHKLRSAVEEMEAE-----EAAARTSSEVTLSSLPANYHNETNTETR 103

  Fly    86 GEHPDKCRQEVPAVFFQYDKEV-KIVGNSSTNPYMNVIEVCC----KGWRRYEYDWSQCV--PDC 143
            .|:...          ...:|| ||..|.|.....:...:..    :|.:.:|     |:  .||
  Rat   104 MENNTA----------HVHREVHKITNNQSGQTVFSETVITSVEDGEGKKSHE-----CIIDEDC 153

  Fly   144 G--ERCQENGFCVAGGKC-----VCFTDFVLNYRNNCVPTCPLG---CPHGRCYLNGTCQCDKGY 198
            |  ..||.:.|......|     :|..|      :.|   |  |   |..|.|    |.:..|| 
  Rat   154 GPTRYCQFSSFKYTCQPCRDQQMLCTRD------SEC---C--GDQLCAWGHC----TQKATKG- 202

  Fly   199 ELDGSRKFCQPQCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNE 263
                        .|.|...|:...:||.| ||  :.|||       ..|:|.|        .|.|
  Rat   203 ------------SNGTICDNQRDCQPGLC-CA--FQRGL-------LFPVCTP--------LPVE 237

  Fly   264 CE-CFPGFQKRKNGITCEGDCYMTCENGFCANKTTC---------VCQNGY--RYDKNTTTCLP 315
            .| |.....:..:.||.|.:.....:...||:...|         :|:..:  .:|.|..:.||
  Rat   238 GELCHDPTSQMLDLITWELEPEGALDRCPCASGLLCQPHSHSLVYMCKPAFVGSHDHNEESQLP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 16/63 (25%)
Prokineticin <208..273 CDD:148298 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.