DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and Dlk1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_038967531.1 Gene:Dlk1 / 114587 RGDID:619931 Length:416 Species:Rattus norvegicus


Alignment Length:347 Identity:88/347 - (25%)
Similarity:128/347 - (36%) Gaps:113/347 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VFFQYDKEVKIV-----GNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGK 158
            :||...::|..|     |::..:|::...::...|        ::|.|.|.   .::|||.|...
  Rat    22 LFFSLGRKVSAVDLENQGDAVLSPWLGAGKIVFLG--------AECDPACD---PQHGFCEADNV 75

  Fly   159 CVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELDGSRKFCQ---PQCNAT-CGHNE 219
            |.|...:.......|| |.| ||.:|.|.....|.|.:|:  ||  |||:   ..|.:| |.:|.
  Rat    76 CRCEPGWEGPLCEKCV-TSP-GCVNGLCEEPWQCVCKEGW--DG--KFCEIDIRACTSTPCANNG 134

  Fly   220 VC--LEPG--KCSCAEGYTRGLRESAALGCQPICIPDCGY--GHCVRPNECECFPGFQKRKNGIT 278
            .|  ||.|  :|||..|::.               .||.:  |.||              .||..
  Rat   135 TCVDLEKGQYECSCTPGFSG---------------KDCQHKAGPCV--------------INGSP 170

  Fly   279 CEGDCYMTCENGFC------ANKTTCVCQNGYR---YDKNTTTCLPDCGDNCDN-GVCISPG--- 330
            |:       ..|.|      |:..:|:|..|:.   .:..|.:|.|   :.|:| |||...|   
  Rat   171 CQ-------HGGACVDDEGRASHASCLCPPGFSGNFCEIVTNSCTP---NPCENDGVCTDIGGDF 225

  Fly   331 NCRCFKGYVRNRERCEAVC---VGGCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCR 392
            .|||..|:|      :..|   |..|. .|.|:....|           .|..:...     .|.
  Rat   226 RCRCPAGFV------DKTCSRPVSNCA-SGPCLNGGTC-----------LQHTQVSF-----ECL 267

  Fly   393 CQ---VGMTRFIDRCMSPDTVT 411
            |:   :|.|....|..||..||
  Rat   268 CKPPFMGPTCAKKRGTSPVQVT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
Dlk1XP_038967531.1 EGF_CA 121..158 CDD:238011 13/51 (25%)
EGF_CA 168..201 CDD:238011 8/39 (21%)
EGF_CA 208..238 CDD:238011 12/38 (32%)
EGF_CA 245..277 CDD:238011 8/48 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.