DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB4 and ESM1

DIOPT Version :9

Sequence 1:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_008967.1 Gene:ESM1 / 11082 HGNCID:3466 Length:184 Species:Homo sapiens


Alignment Length:163 Identity:39/163 - (23%)
Similarity:48/163 - (29%) Gaps:63/163 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 VLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELD--GSRKFCQPQCNATCGHNEVCLEPGKCS 228
            |..:.||....||..|....|..:..|   |...||  |..:.|......||......::..||.
Human    17 VAAWSNNYAVDCPQHCDSSECKSSPRC---KRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCG 78

  Fly   229 CAEGYTRGLRESAALGCQP------------ICIPDCGYGHCVRPNECECFPGFQKRKNGITCEG 281
                  .|||      |||            || .||.||                 ..|:.|..
Human    79 ------PGLR------CQPSNGEDPFGEEFGIC-KDCPYG-----------------TFGMDCRE 113

  Fly   282 DCYMTCENGFCANKTTCVCQNGYRYDKNTTTCL 314
            .|  .|::|.|              |:.|..||
Human   114 TC--NCQSGIC--------------DRGTGKCL 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
ESM1NP_008967.1 IB 26..100 CDD:197525 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.