DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and SCARF1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_003684.2 Gene:SCARF1 / 8578 HGNCID:16820 Length:830 Species:Homo sapiens


Alignment Length:391 Identity:102/391 - (26%)
Similarity:129/391 - (32%) Gaps:146/391 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SQTRERQQHLCHREVPSVFFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANEC-VPDCSASS 112
            |:...:.||:|....||...|                     ||||:|:..  .|| :|.|  ..
Human    20 SELDPKGQHVCVASSPSAELQ---------------------CCAGWRQKD--QECTIPIC--EG 59

  Fly   113 PDNC-RNGFCRSPGVCECFAEFVRNEHGA--------------CIHTCPIACQ-HGRCY-LNGTC 160
            ||.| ::..|..||:|.|...|    .||              |..:||  |. ||:|. ..|.|
Human    60 PDACQKDEVCVKPGLCRCKPGF----FGAHCSSRCPGQYWGPDCRESCP--CHPHGQCEPATGAC 118

  Fly   161 VCHQNFVLDQETRQFCRPKCSQSCGTHEEC-VAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKC- 223
            .|       |..|...|.:...:||.|..| .|.|.|.|.||:..:.   |:..|..:....:| 
Human   119 QC-------QADRWGARCEFPCACGPHGRCDPATGVCHCEPGWWSST---CRRPCQCNTAAARCE 173

  Fly   224 VAPNQCECFAGFIKRPNW--NVCEAECYLNCENGLCE-SRYKCHCREGYRYDVNTTSCLPECSDN 285
            .|...|.|      :|.|  ..|...|  ||....|| ...:|.||.|:        ..|||...
Human   174 QATGACVC------KPGWWGRRCSFRC--NCHGSPCEQDSGRCACRPGW--------WGPECQQQ 222

  Fly   286 CGQGNGVC-IAPGVCRC---FRGYEV--------HGAECRPKCESRFCGKYGRCVAPEIC----- 333
            |....|.| .|.|.|.|   |||...        ||.:|...|        |||...|.|     
Human   223 CECVRGRCSAASGECTCPPGFRGARCELPCPAGSHGVQCAHSC--------GRCKHNEPCSPDTG 279

  Fly   334 -------------------------GCGEGQQHCRNG-SCD-DIEHCS--------------CPS 357
                                     .|.:...|||:| :|: |..||.              ||:
Human   280 SCESCEPGWNGTQCQQPCLPGTFGESCEQQCPHCRHGEACEPDTGHCQRCDPGWLGPRCEDPCPT 344

  Fly   358 G 358
            |
Human   345 G 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
SCARF1NP_003684.2 CSRNP_N <100..135 CDD:292638 12/43 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 581..688
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.