DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and MEGF11

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens


Alignment Length:452 Identity:119/452 - (26%)
Similarity:162/452 - (35%) Gaps:145/452 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAGLTALLTLVAFPVQIKTDSTVST--ELYGDIENTEYG-DFESLSQTRERQQHLC--------- 59
            |.||.|...|.|.......|..|.:  |.|.......|. .|:.:..||      |         
Human     5 LTGLIAFSFLQATLALNPEDPNVCSHWESYAVTVQESYAHPFDQIYYTR------CTDILNWFKC 63

  Fly    60 --HREVPSVFFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDCSASSPDNCRNGFCR 122
              ||    :.::|.....:|    |:|..|.: ||.||...  .:.|:|.|:    :.|.:|.|.
Human    64 TRHR----ISYKTAYRRGLR----TMYRRRSQ-CCPGYYES--GDFCIPLCT----EECVHGRCV 113

  Fly   123 SPGVCEC--------FAEFVRNEHGA--CIHTCPIACQHGR-CY-LNGTCVCHQNFVLDQETRQF 175
            ||..|.|        .:....::|..  |.:.|  .||:|. |. :.|.|||...|      |.:
Human   114 SPDTCHCEPGWGGPDCSSGCDSDHWGPHCSNRC--QCQNGALCNPITGACVCAAGF------RGW 170

  Fly   176 CRPKCSQSC--GTH-EECVAP-------------GQCDCSPGYRRTPDLGCQPVCAP-----DCG 219
               :|.:.|  ||| :.|..|             |:|.|:|||   ..:.|:.:|.|     .|.
Human   171 ---RCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECLCAPGY---TGVYCEELCPPGSHGAHCE 229

  Fly   220 FGKCVAPN---------QCECFAGFIKRPNWN--VCEAEC-----YLNC-------ENGLCES-R 260
            . :|...|         :|.|      .|.|.  ||...|     ..||       ..|.|:. .
Human   230 L-RCPCQNGGTCHHITGECAC------PPGWTGAVCAQPCPPGTFGQNCSQDCPCHHGGQCDHVT 287

  Fly   261 YKCHCREGYRYDVNTTSCLP------ECSDNCGQGNGVCIAP--GVCRCFRGYEVHGAECRPKCE 317
            .:|||..||..|.....| |      :||.:|...||...:|  |.|.|..||:      .|:|:
Human   288 GQCHCTAGYMGDRCQEEC-PFGSFGFQCSQHCDCHNGGQCSPTTGACECEPGYK------GPRCQ 345

  Fly   318 SRFC--GKYG-RCVAPEICGCGEGQQ---HCRNGSCD-----DIEHC--SCPSGETHFIDRC 366
            .|.|  |.:| .|..|  |.|.....   |...|:|.     ...||  |||.|  ::.|.|
Human   346 ERLCPEGLHGPGCTLP--CPCDADNTISCHPVTGACTCQPGWSGHHCNESCPVG--YYGDGC 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
MEGF11NP_001371957.1 EMI 26..93 CDD:400092 18/81 (22%)
EGF_CA 275..320 CDD:419698 13/45 (29%)
EGF_CA 362..409 CDD:419698 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.