DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and dkk1a

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001268729.2 Gene:dkk1a / 799377 ZFINID:ZDB-GENE-090313-406 Length:247 Species:Danio rerio


Alignment Length:247 Identity:57/247 - (23%)
Similarity:75/247 - (30%) Gaps:102/247 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PDCSASSPDNCRNG-FCR-SPGVC-ECFAEFVRNEHGACIHTCPIACQHGRCYLNGTC------- 160
            |.|||.|  .|..| ||. |.||| .|     |.....|... .:.|...|| :||.|       
Zfish    66 PHCSADS--ECSIGEFCNGSRGVCLSC-----RKRRKRCARD-GMCCAGNRC-INGVCQLADAAA 121

  Fly   161 --------------------VCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRT 205
                                ...|||...:.|....:|:.:|..|..|.|:.             
Zfish   122 VGSADASPPGGNTDVSGVAVTRGQNFTHPRRTTVLSKPQQTQKGGEGETCLR------------- 173

  Fly   206 PDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWN-VCEAECYLNCENGLCESRYKCHCREGY 269
                     :.||..|.|.|            |..|: :|:.   :..|..:|..    |.|:| 
Zfish   174 ---------SSDCLEGLCCA------------RHFWSRICKP---VLTEGQVCTR----HRRKG- 209

  Fly   270 RYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRGYEVHGAE------CRPK 315
               .:.......|  :||.|.       .||..|  |..|||      |:|:
Zfish   210 ---AHGLEIFQRC--DCGSGL-------TCRGQR--EKPGAESRNLHTCQPR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
dkk1aNP_001268729.2 Dickkopf_N 68..115 CDD:282549 20/55 (36%)
COLIPASE 167..236 CDD:305210 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.