DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and TNFAIP6

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_009046.2 Gene:TNFAIP6 / 7130 HGNCID:11898 Length:277 Species:Homo sapiens


Alignment Length:169 Identity:38/169 - (22%)
Similarity:57/169 - (33%) Gaps:67/169 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CSPGYRRTPDLGCQPVC--APDCGFGK-------------------CVAPNQCECFAGF------ 235
            |:.|:.....:| .|:.  .|:|||||                   |..|:..||...|      
Human    82 CAAGWMAKGRVG-YPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQI 145

  Fly   236 IKRPNW-NVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVC 299
            .|.|.: |..|       :|.:|    ..|.|..|...::.:....:..|:.|     |:|..| 
Human   146 FKSPGFPNEYE-------DNQIC----YWHIRLKYGQRIHLSFLDFDLEDDPG-----CLADYV- 193

  Fly   300 RCFRGY-EVHGAECRPKCESRFCGKYGRCVAPEICGCGE 337
            ..:..| :|||          |.|:|          ||:
Human   194 EIYDSYDDVHG----------FVGRY----------CGD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
TNFAIP6NP_009046.2 Link_domain_TSG_6_like 36..128 CDD:239592 10/46 (22%)
CUB 135..244 CDD:278839 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.