DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and tnfaip6

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:229 Identity:48/229 - (20%)
Similarity:72/229 - (31%) Gaps:91/229 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 HCSGPLAGLTALLTLVA-FPVQIKTDSTVSTELY----GDIENTEY-----GDFESLSQTRERQQ 56
            ||     ||.|:..|.| |.|.|...   .||.:    |.:.|:.:     |.:.  .::|:.:.
Zfish     3 HC-----GLRAMRALTAVFGVLIVLK---ETEAWGYKNGILHNSIWLEQAAGVYH--RESRKGRY 57

  Fly    57 HLCHREVPSV----------FFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDCSAS 111
            .|.::|..:|          |.|.|.       ...|.||   ||.||:.               
Zfish    58 QLTYKEAKAVCNFEGGTLATFDQLEA-------ARQIGFH---VCAAGWL--------------- 97

  Fly   112 SPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETR--Q 174
              |..|.|:                         ||......|......:....:.|::..|  .
Zfish    98 --DKGRVGY-------------------------PIVKAGSNCGFGKVGIIDYGYRLNKSERWDV 135

  Fly   175 FCRPKCSQSC-GTHEECVAPGQCDCSPGYRRTPD 207
            :|....::.| |.|.:   |.:...||||   ||
Zfish   136 YCYNPVAKECGGVHTD---PEKVLVSPGY---PD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 23/145 (16%)
CUB 145..254 CDD:278839 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.