DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Dkk2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_006501881.1 Gene:Dkk2 / 56811 MGIID:1890663 Length:272 Species:Mus musculus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:67/223 - (30%) Gaps:68/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSPDNCRNG-FCRSP--GVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQET 172
            ||...|..| :|.||  |...|.  ..|.:...| |...:.|...||. ||.|:        ..|
Mouse    92 SSDKECEVGRYCHSPHQGSSACM--LCRRKKKRC-HRDGMCCPGTRCN-NGICI--------PVT 144

  Fly   173 RQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIK 237
            .....|......||...       |.:.|:....|||.|.:..|..                  |
Mouse   145 ESILTPHIPALDGTRHR-------DRNHGHYSNHDLGWQNLGRPHS------------------K 184

  Fly   238 RPNWNVCEAECYL---NCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVC 299
            .|:....|.:..|   :|.:|.|.:|:           ..|..|.|...    ||.       ||
Mouse   185 MPHIKGHEGDPCLRSSDCIDGFCCARH-----------FWTKICKPVLH----QGE-------VC 227

  Fly   300 RCFRGYEVHGAECRPKCESRFCGKYGRC 327
            ...|....||.|...:|:   |.|...|
Mouse   228 TKQRKKGSHGLEIFQRCD---CAKGLSC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Dkk2XP_006501881.1 Dickkopf_N 91..141 CDD:368068 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.