DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and megf11

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:477 Identity:115/477 - (24%)
Similarity:154/477 - (32%) Gaps:217/477 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAEF 133
            :|...:..|....|:|..|.: ||.||...  .:.|||.||    :.|.:|.|.||..|:|    
Zfish    73 RTSYKTAYRRGVRTMYRRRSQ-CCPGYFES--GDLCVPRCS----EECAHGRCVSPDTCQC---- 126

  Fly   134 VRNEHGACIHTCPIACQHG--------RCY---------LNGTCVCHQNFVLDQETR--QFCRP- 178
               |.|.....|...|:.|        ||.         :.|.|||...:   |..|  ..|.| 
Zfish   127 ---EPGWGGLDCSSGCESGYWGPHCSNRCQCKNGALCNPITGACVCTDGY---QGWRCEDLCEPG 185

  Fly   179 ----------KCSQSCGTHEECVAPGQCDCSPGY-------------------RRTPDLGCQ--- 211
                      :|......|.|   .|:|.|:|||                   :|.|   ||   
Zfish   186 YYGKGCQLQCQCLNGATCHHE---TGECICAPGYMGPICGERCPSGSHGPQCEQRCP---CQNGG 244

  Fly   212 -----------------PVCAPDCGFGK--------CVAPN---------QCECFAGFIKRPNWN 242
                             .|||..|.|||        |...|         ||:|.||:    :.:
Zfish   245 TCHHITGECSCPAGWTGSVCAQPCPFGKYGINCSKECSCRNGGLCDHITGQCQCMAGY----SGH 305

  Fly   243 VCEAEC-----------YLNCENG----------LCESRYK-CHCREGY-----------RY--- 271
            .|:.||           :.:|:||          ||::.:| .||::.:           :|   
Zfish   306 RCQEECPVGTYGPQCTLHCDCQNGAKCYHINGACLCDTGFKGHHCQDRFCPPGLYGLICDKYCPC 370

  Fly   272 -DVNTTSCLP---ECS-----------DNC-----GQGNGV---CI-------APGVCRCFRGYE 306
             ..||.||.|   |||           :.|     |:|.||   |.       ..|.|.|..||.
Zfish   371 NSTNTISCHPLTGECSCTAGWTGLYCNETCPPGYYGEGCGVPCQCANGADCHSLTGACICAPGYT 435

  Fly   307 VHGAECRPKCESRFCGKY-----------------GRCVAPE---------IC-------GCGEG 338
              |.:|...|.|...|..                 |.|:..|         :|       ||.: 
Zfish   436 --GDDCSQTCPSGLFGTNCTSICHCHNQASCSPIDGSCICKEGWQGVDCSILCSSGTWGLGCNQ- 497

  Fly   339 QQHCRNG-SCDDIE-HCSCPSG 358
            ...|.|| :||.|: .|:|.||
Zfish   498 TCLCANGAACDPIDGSCTCSSG 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
megf11XP_009291879.1 EMI 32..98 CDD:311482 7/25 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.