DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and ccbe1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001157395.1 Gene:ccbe1 / 555629 ZFINID:ZDB-GENE-090506-7 Length:401 Species:Danio rerio


Alignment Length:255 Identity:62/255 - (24%)
Similarity:80/255 - (31%) Gaps:91/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 QETRQFCRPKCSQS--CGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECF 232
            :|.....|..||:|  ..|...||.      |.|...|            |...||     ||.|
Zfish    29 EEKEDVDREVCSESKIATTKYPCVK------STGEVTT------------CYRKKC-----CEGF 70

  Fly   233 AGFIKRPNWNVCEAECYLNCENGLCE-------SRYKCHCREGYRYD------VNTTSCL--PEC 282
            ...:.:     |..|.|..|....||       .|..|.|.:|||||      .....||  .||
Zfish    71 KFVLGQ-----CIPEDYDVCAGAPCEQQCTDHFGRVVCTCYDGYRYDRERHRNREKPYCLDIDEC 130

  Fly   283 SDN----CGQGNGVCI-APGV--CRCFRGY--EVHGAEC-----RPKCE-SRFCGKYGRCVAPEI 332
            ::|    |.|   :|: .||.  |.|..|:  |..|..|     .|..| |....|.|.|.|   
Zfish   131 ANNNETVCSQ---MCVNTPGSYRCDCHSGFYLEDDGKTCTKGERAPLFEKSDNVMKEGTCSA--- 189

  Fly   333 CGCGEGQQHCRNGSCDDIEHCSCPSGETHFIDRCLKADRLSQHLNTSEKRKHFNRQLAYE 392
                         :|:|            |....:...:|.|.::........|:|:..|
Zfish   190 -------------TCED------------FHQMKMTVLQLKQKMSLLSSNTEINKQMTNE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
ccbe1NP_001157395.1 FXa_inhibition 130..166 CDD:291342 12/38 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..321
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.