| Sequence 1: | NP_001260452.1 | Gene: | NimB1 / 34813 | FlyBaseID: | FBgn0027929 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001347186.1 | Gene: | Dkk3 / 50781 | MGIID: | 1354952 | Length: | 366 | Species: | Mus musculus |
| Alignment Length: | 201 | Identity: | 42/201 - (20%) |
|---|---|---|---|
| Similarity: | 65/201 - (32%) | Gaps: | 56/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 150 QHGRCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQP-- 212
Fly 213 ----VCAPDCGFGKCVAPNQC---ECFAGFIKRPNWNVCEAECYLNCENGLCESRYK-------- 262
Fly 263 --------CHCREGYRYDVNTTSCLPE-CSDNCGQGNGVCIAPGVCRCFRGYEVHGAECRPKCES 318
Fly 319 RFCGKY 324 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||