DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and CG7381

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_650242.1 Gene:CG7381 / 41589 FlyBaseID:FBgn0038098 Length:712 Species:Drosophila melanogaster


Alignment Length:396 Identity:90/396 - (22%)
Similarity:134/396 - (33%) Gaps:155/396 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SQTRERQQHLCHREVPSVF-FQTE-----------RD----------SPVRGNGSTIYFHRIEVC 91
            |...:|..|...|.:|::| |..|           ||          |....||.|         
  Fly   325 SSRNQRHAHGQRRRLPALFRFDDEDIKTYSTLGSSRDDDDADEKKYGSSCTDNGKT--------- 380

  Fly    92 CAGYRRDPYA----NECVPDCSASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHG 152
            |:|.   |::    |.|:          ||.|:....|  :||||...      |......|::.
  Fly   381 CSGL---PHSICSKNICL----------CRQGYYARNG--KCFAELGE------IAESTDECEYE 424

  Fly   153 RCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPD 217
            ...|..||.|.:|:..:::.|     .|.:....|..|.:..|  |||       .|.. .|.|:
  Fly   425 FDQLTKTCNCQKNYFYERDLR-----NCRKPIQYHLSCTSNSQ--CSP-------FGAS-YCHPE 474

  Fly   218 CGFGKCVAPNQCEC--FAGF--IKRPNWNVCE------AECYLN--C--ENGLCESRYKCHCREG 268
                   .|.:|.|  :|.:  ||:    :||      |||..|  |  ::.:|.:|. |.|.:.
  Fly   475 -------IPRRCTCEEYALYDAIKQ----LCEYKRGLGAECESNDGCPVDHSVCSNRV-CVCADN 527

  Fly   269 YRYDVNTTSCLPECSDNCGQGNGV-------CIAPG-------------VCRCFRGYE------- 306
            |.          |..|.|.:|.|.       ||...             .|:|.:||.       
  Fly   528 YF----------EKDDQCMRGIGADCSVEDDCIPENTECQEKDEEDQSRTCQCRKGYVHFKDECL 582

  Fly   307 ----------VHGAECRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCDDIEHC--SCPSGE 359
                      |...:|:|...|  |...|:      |||.: :||.:||.|:.....  ||....
  Fly   583 KEAEELEDECVEDEQCKPLLAS--CNSEGK------CGCND-EQHAKNGVCETKRELGESCTKAT 638

  Fly   360 THFIDR 365
            ..::::
  Fly   639 ECYVEK 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
CG7381NP_650242.1 EB 68..112 CDD:279949
EB 101..155 CDD:279949
EB 570..624 CDD:279949 16/62 (26%)
EB 613..665 CDD:279949 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.