DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and CG15861

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001286863.1 Gene:CG15861 / 37990 FlyBaseID:FBgn0035084 Length:205 Species:Drosophila melanogaster


Alignment Length:189 Identity:63/189 - (33%)
Similarity:74/189 - (39%) Gaps:42/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 SQSCGTHEECVA-PGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCEC----FAGFIKRPN 240
            ||.|..:|..|. ..||     .||     |..||..    |.|.....|.|    .||   .|:
  Fly    33 SQLCSDYEMLVVNTRQC-----VRR-----CNIVCLN----GVCFEDGSCPCADQYMAG---NPD 80

  Fly   241 WNVCEAECYLNC--ENGLCESRYKCHCREG--YRYDVNTTSC-------LPECSDNCGQGNGVCI 294
            ..||.|||...|  ..|.|.:...|.|||.  |.:|..:..|       |..|...|..||  |.
  Fly    81 GLVCAAECLPGCVAAGGYCAAPDLCVCREDRHYYFDPLSQKCRHRAPRLLDPCLGRCTHGN--CS 143

  Fly   295 APGVCRCFRGYE-----VHGAECRPKCESRFCGKYGRCVAPEICGCGEGQQH-CRNGSC 347
            :.|.|.|.:|||     :||.:|.|.|:.. ||....|.||.:|.|...|.| ..||.|
  Fly   144 SDGRCICAQGYELRDSLLHGQQCMPICDHN-CGPRAYCFAPNLCACRHKQHHYAHNGIC 201



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D97941at2759
OrthoFinder 1 1.000 - - FOG0014295
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.