DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and PEAR1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_016856723.1 Gene:PEAR1 / 375033 HGNCID:33631 Length:1125 Species:Homo sapiens


Alignment Length:374 Identity:96/374 - (25%)
Similarity:118/374 - (31%) Gaps:150/374 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PYANECVPDCSASSPDNC----------------RNGFCRSPGVC------ECFAEFVRNEHGAC 141
            |..:.|.|...||.|...                |:.||.   ||      ..:.:.|:.:|.  
Human   114 PAPSACSPQSPASGPGRAPILAPSPQTQRKLLASRDSFCM---VCVGVVYRTVYRQVVKTDHR-- 173

  Fly   142 IHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTP 206
                    |..:|       ||..:    |:|.||.|.|:|.| .|..||||.||.|.||:|.. 
Human   174 --------QRLQC-------CHGFY----ESRGFCVPLCAQEC-VHGRCVAPNQCQCVPGWRGD- 217

  Fly   207 DLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWNVCEA-------ECYLNCENG----LCESR 260
              .|...|||.....:|..|  |.|.......|...||..       .|...|..|    .|:.|
Human   218 --DCSSECAPGMWGPQCDKP--CSCGNNSSCDPKSGVCSCPSGLQPPNCLQPCTPGYYGPACQFR 278

  Fly   261 YKCHCREGYRYDVNTTSCL-------PECSDNCGQG-------------NG-------------- 291
            .:||   |...|..|.:|.       |.|..:|.||             ||              
Human   279 CQCH---GAPCDPQTGACFCPAERTGPSCDVSCSQGTSGFFCPSTHSCQNGGVFQTPQGSCSCPP 340

  Fly   292 -----VCIAP--------------------------GVCRCFRGYEVHGAECRPKCESRFCGKYG 325
                 :|..|                          |.|||..||.  |..||.:|.   .|::|
Human   341 GWMGTICSLPCPEGFHGPNCSQECRCHNGGLCDRFTGQCRCAPGYT--GDRCREECP---VGRFG 400

  Fly   326 RCVAPEICGCGEGQQHC--RNGSCDDIEHCSCPSGETHFIDRCLKADRL 372
            :..| |.|.|.. ...|  .||:      |.|..|.|.  |||  .|||
Human   401 QDCA-ETCDCAP-DARCFPANGA------CLCEHGFTG--DRC--TDRL 437



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.