DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and NimC2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001285922.1 Gene:NimC2 / 34818 FlyBaseID:FBgn0028939 Length:701 Species:Drosophila melanogaster


Alignment Length:434 Identity:128/434 - (29%)
Similarity:162/434 - (37%) Gaps:126/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YGDFESLSQTRERQQHLCHREVPSVFFQTERDSPVRGNG-STIYFHRIEVCCA--GYRR------ 97
            :||..:.::.|....|.....||.:.      .|:..:| :..|....|||..  ||..      
  Fly   190 HGDCVAPNECRCHPGHEQRLGVPWIC------DPICSSGCANGYCQGAEVCACKMGYAHKDNTLA 248

  Fly    98 ---DPYAN----------------------------ECVPDCSASSPDNCRNGFCRSPGVCECFA 131
               :|..|                            ||||.|.:    .|.||:|.|||.|||..
  Fly   249 SGCEPVCNPPCTNGTCISPGHCACSEGHVFAEGSRHECVPSCRS----GCENGYCSSPGRCECHE 309

  Fly   132 EFVRNEHGACIHTCPIAC-QHGRCYLNGTCVCHQNFV-LDQETRQ-------------------- 174
            .|.:.....|..||...| |:.||....||.|...:| ::..|.:                    
  Fly   310 GFEKTSPHRCSPTCRPGCGQNSRCAAPDTCACDVGYVFVNGSTTECEPFCPRNCRNGICSSPGVC 374

  Fly   175 ------------FCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLG---CQPVCAPDCGFGKCV 224
                        :|.|.||::| .|..||||.:|.|..|||..|.||   |:|:|:..|..|.|:
  Fly   375 TCLEGFQALLSFYCIPVCSKTC-IHGSCVAPNECRCFTGYRPNPSLGANVCEPICSQGCVHGFCI 438

  Fly   225 APNQCECFAGFIKRPNWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTS-CLPECSDNCGQ 288
            ||..|:|..|||||.....||..|...|.|..|.....|.|.|||:....:|| |.|||...|  
  Fly   439 APEICQCDLGFIKRWATGTCEPHCPQKCVNSHCLGSGVCRCYEGYKLRPGSTSICDPECQPGC-- 501

  Fly   289 GNGVCIAPGVCRCFRGYEVHGA------ECRPKCESRFCGKYGRCVAPEICGCGEG--------- 338
            .||.|:.|..|.||.|||....      .|||:||:      |||.:|..|.|..|         
  Fly   502 RNGTCVEPNSCACFAGYEDTKVPYECVPSCRPRCEN------GRCSSPGHCECDPGHVVTNSSEP 560

  Fly   339 -------QQHCRNGSCDDIEHCSC-------PSGETHFIDRCLK 368
                   |:.|.|..|...|.|:|       |...|.....|.|
  Fly   561 NSCRPQCQEQCINAECVAPEKCACLPRYRFLPDSSTECEPICSK 604



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.