DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and NimC1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster


Alignment Length:406 Identity:116/406 - (28%)
Similarity:155/406 - (38%) Gaps:122/406 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NTEYGDFESLSQTRERQQHLCHREVPSVFFQTERDSPVRGNGSTIYFHRIEVCCA--GYRRDPYA 101
            |..||..:            ||...|:|.            |...:..|..||..  ||:|...:
  Fly   118 NAGYGGID------------CHPVCPTVC------------GKNEFCDRPGVCSCQNGYKRTSPS 158

  Fly   102 NECVPDCSASSPDNC-RNGFCRSPGVCEC------------FAE-FVRNEHGACIHTCPIAC-QH 151
            :.|:|.|.    ..| .:.||..||.|||            |.: :..|.:|.|...||..| |:
  Fly   159 DNCLPVCE----KECGHHSFCSEPGKCECEPGYEKVGNGTVFPDGYKNNSNGNCSPICPKDCGQN 219

  Fly   152 GRCYLNGTCVCHQNFVLDQETRQFCRPKCS-------------------------------QSCG 185
            .||...|.|.|...:..|..... |||.||                               :.|.
  Fly   220 SRCVRPGVCECENGYAGDDGGTN-CRPVCSTCPENGLCLSPGVCVCKPGYVMRNDLCQPHCEKCS 283

  Fly   186 THEECVAPGQCDCSPGYRRT-PDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWNVCEAECY 249
            .:..||||.||:|.|||..: .|..|.|.|:..|..|.|.||..|.|..|:...|| .|||.:|.
  Fly   284 DNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCSIGYQMGPN-QVCEPKCS 347

  Fly   250 LNCENGLCESRYKCHCREGYRYDVNT-TSCLPECSDNCGQGNGVCIAPGVCRCFRGYEVHGAE-- 311
            |||.:|.|.|...|.|..|||:..|: ..|.|.|...|  .||.|:||..|.|..||:::...  
  Fly   348 LNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICDSGC--SNGHCVAPNFCICHDGYQLNSTNPV 410

  Fly   312 ---CRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCD------------------------- 348
               |:|.|:.  | ::|.||||.:|.|..|.::. ||.|:                         
  Fly   411 TSMCQPICKG--C-QFGDCVAPNVCECNVGYENI-NGLCELQTTTDSYEYSTTTVELQSSTVDPQ 471

  Fly   349 ------DIEHCSCPSG 358
                  ::.|.:|.:|
  Fly   472 LQTSTSEVPHSNCTAG 487



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.