DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and NimB4

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_788046.1 Gene:NimB4 / 34814 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster


Alignment Length:364 Identity:174/364 - (47%)
Similarity:230/364 - (63%) Gaps:25/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 RQQH--LCHREVPSVFFQTERDSPVRGNGST-IYFHRIEVCCAGYRRDPYA-NECVPDCSASSPD 114
            |.:|  .|.:|||:||||.:::..:.||.|| .|.:.|||||.|:||..|. ::|||||.    :
  Fly    85 RGEHPDKCRQEVPAVFFQYDKEVKIVGNSSTNPYMNVIEVCCKGWRRYEYDWSQCVPDCG----E 145

  Fly   115 NCR-NGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRP 178
            .|: ||||.:.|.|.||.:||.|....|:.|||:.|.||||||||||.|.:.:.|| .:|:||:|
  Fly   146 RCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLGCPHGRCYLNGTCQCDKGYELD-GSRKFCQP 209

  Fly   179 KCSQSCGTHEECVAPGQCDCSPGY----RRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRP 239
            :|:.:||.:|.|:.||:|.|:.||    |.:..|||||:|.||||:|.||.||:||||.||.||.
  Fly   210 QCNATCGHNEVCLEPGKCSCAEGYTRGLRESAALGCQPICIPDCGYGHCVRPNECECFPGFQKRK 274

  Fly   240 NWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRG 304
            |...||.:||:.||||.|.::..|.|:.|||||.|||:|||:|.|||  .|||||:||.||||:|
  Fly   275 NGITCEGDCYMTCENGFCANKTTCVCQNGYRYDKNTTTCLPDCGDNC--DNGVCISPGNCRCFKG 337

  Fly   305 YEVHGAECRPKCESRFCGKYGRCVAPEICGCG------EGQQHCRNGSCDDIEHCSCPSGETHFI 363
            |..:...|...|... ||.||:|:||.:|||.      ...|.|..|.|:.:..|.|..|.|.||
  Fly   338 YVRNRERCEAVCVGG-CGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRCRCQVGMTRFI 401

  Fly   364 DRCLKADRLSQHLNTSEKRKHFNRQLAYEFNALIGRLFN 402
            |||:..|.::.:.:.:..:  .|..|..|||.|:||.||
  Fly   402 DRCMSPDTVTTYASMNPVK--VNASLIQEFNLLLGRHFN 438



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469379
Domainoid 1 1.000 66 1.000 Domainoid score I9676
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 1 1.000 - - FOG0014295
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.