DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and CG11674

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:243 Identity:60/243 - (24%)
Similarity:87/243 - (35%) Gaps:61/243 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SCGTHEECV--APGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWNVCE 245
            ||.:..:|.  ..|:|         .|:.|  :|... |.|:.|   .|......:|..  |:..
  Fly    28 SCSSDAQCAQFERGRC---------VDMAC--ICTAR-GSGERV---PCTPLEERLKLT--NIIG 75

  Fly   246 AECYLNCENGLCESRY-KCHCREGYRYDVNTTSCLP---------ECSDNCGQGN--GVCIAPGV 298
            ..|.....|.:|.:|: :|||.||:....:...|||         |....|.:.:  ..||. ..
  Fly    76 GACPCPMPNAICHTRWQQCHCSEGHVSSDDRRRCLPAVVPVGGSCEFQQQCQRADRFSSCIG-NQ 139

  Fly   299 CRCFRGYEVHGAEC----RPKC-ESRFCGKYGRCVA---PEICGCGEGQQH------CRNGSC-- 347
            |.|...:|.|...|    :..| |.:.||..|..:.   .:.|||.:...|      |..||.  
  Fly   140 CLCLNQFEFHEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNMTKCIKGSAYG 204

  Fly   348 DDIEH---CSCPSGETHFIDRCLKADRLSQHLNTSEKRKHFNRQLAYE 392
            |..||   |....|..   .|||      .||... :..|:.:::|.|
  Fly   205 DTCEHSSPCKLNLGAD---GRCL------DHLCVC-RSTHYPKRVANE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 14/57 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.